KEGG   Homo sapiens (human): 7070Help
Entry
7070              CDS       T01001                                 

Gene name
THY1, CD90, CDw90
Definition
(RefSeq) Thy-1 cell surface antigen
  KO
K06514  Thy-1 cell surface antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    7070 (THY1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7070 (THY1)
   04090 CD molecules [BR:hsa04090]
    7070 (THY1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    7070 (THY1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   7070 (THY1)
CD molecules [BR:hsa04090]
 Proteins
  7070 (THY1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Antigens
  7070 (THY1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ig V-set Ig_3 I-set zf-C5HC2 Ig_2
Motif
Other DBs
NCBI-GeneID: 7070
NCBI-ProteinID: NP_001298089
OMIM: 188230
HGNC: 11801
Ensembl: ENSG00000154096
Vega: OTTHUMG00000166202
Pharos: P04216(Tbio)
UniProt: P04216 B0YJA4
Position
11q23.3
AA seq 161 aa AA seqDB search
MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKK
HVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNV
TVLRDKLVKCEGISLLAQNTSWLLLLLLSLSLLQATDFMSL
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgaacctggccatcagcatcgctctcctgctaacagtcttgcaggtctcccgagggcag
aaggtgaccagcctaacggcctgcctagtggaccagagccttcgtctggactgccgccat
gagaataccagcagttcacccatccagtacgagttcagcctgacccgtgagacaaagaag
cacgtgctctttggcactgtgggggtgcctgagcacacataccgctcccgaaccaacttc
accagcaaatacaacatgaaggtcctctacttatccgccttcactagcaaggacgagggc
acctacacgtgtgcactccaccactctggccattccccacccatctcctcccagaacgtc
acagtgctcagagacaaactggtcaagtgtgagggcatcagcctgctggctcagaacacc
tcgtggctgctgctgctcctgctctccctctccctcctccaggccacggatttcatgtcc
ctgtga

DBGET integrated database retrieval system