KEGG   Homo sapiens (human): 7167
Entry
7167              CDS       T01001                                 

Gene name
TPI1, HEL-S-49, TIM, TPI, TPID
Definition
(RefSeq) triosephosphate isomerase 1
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00051  Fructose and mannose metabolism
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01230  Biosynthesis of amino acids
Module
hsa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hsa_M00002  Glycolysis, core module involving three-carbon compounds
hsa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Disease
H00664  Anemia due to disorders of glycolytic enzymes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    7167 (TPI1)
   00051 Fructose and mannose metabolism
    7167 (TPI1)
   00562 Inositol phosphate metabolism
    7167 (TPI1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7167 (TPI1)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     7167 (TPI1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   7167 (TPI1)
  Exosomal proteins of bladder cancer cells
   7167 (TPI1)
  Exosomal proteins of melanoma cells
   7167 (TPI1)
SSDB
Motif
Pfam: TIM
Other DBs
NCBI-GeneID: 7167
NCBI-ProteinID: NP_000356
OMIM: 190450
HGNC: 12009
Ensembl: ENSG00000111669
Vega: OTTHUMG00000133767
Pharos: P60174(Tbio)
UniProt: P60174
Structure
PDB: 

Position
12p13.31
AA seq 249 aa
MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKI
AVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDELIGQKVAHALAE
GLGVIACIGEKLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQ
QAQEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPE
FVDIINAKQ
NT seq 750 nt   +upstreamnt  +downstreamnt
atggcgccctccaggaagttcttcgttgggggaaactggaagatgaacgggcggaagcag
agtctgggggagctcatcggcactctgaacgcggccaaggtgccggccgacaccgaggtg
gtttgtgctccccctactgcctatatcgacttcgcccggcagaagctagatcccaagatt
gctgtggctgcgcagaactgctacaaagtgactaatggggcttttactggggagatcagc
cctggcatgatcaaagactgcggagccacgtgggtggtcctggggcactcagagagaagg
catgtctttggggagtcagatgagctgattgggcagaaagtggcccatgctctggcagag
ggactcggagtaatcgcctgcattggggagaagctagatgaaagggaagctggcatcact
gagaaggttgttttcgagcagacaaaggtcatcgcagataacgtgaaggactggagcaag
gtcgtcctggcctatgagcctgtgtgggccattggtactggcaagactgcaacaccccaa
caggcccaggaagtacacgagaagctccgaggatggctgaagtccaacgtctctgatgcg
gtggctcagagcacccgtatcatttatggaggctctgtgactggggcaacctgcaaggag
ctggccagccagcctgatgtggatggcttccttgtgggtggtgcttccctcaagcccgaa
ttcgtggacatcatcaatgccaaacaatga

DBGET integrated database retrieval system