KEGG   Homo sapiens (human): 729475Help
Entry
729475            CDS       T01001                                 

Gene name
RAD51AP2
Definition
(RefSeq) RAD51 associated protein 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: RAD51_interact
Motif
Other DBs
NCBI-GeneID: 729475
NCBI-ProteinID: NP_001092688
HGNC: 34417
Ensembl: ENSG00000214842
Vega: OTTHUMG00000151761
Pharos: Q09MP3(Tdark)
UniProt: Q09MP3
Position
2p24.2
AA seq 1159 aa AA seqDB search
MSLPQPTPRMAELRKPTSSLTPPEDPDSQPPSSKRLCLEEPGGVFKAGWRLPLVPRLSEA
EKVWELSPRPFKGLLVSTNAIFDNSTDSCVEKSVSGKQICNLKCSNLKFQMSSCLQSPPS
QSPDSDLRASGRSEAGLHDREAFSVHRSNSSKAGVSQLLPSTSIHDIHGIRNENRKQQFV
QGRDNVHKENPFLDVTFYKETKSPFHEIKNRCKANSVVPSNKRENNISSSVLKISKSQNQ
PSLEIAKPSYFRDSGTISVPQFPMDLNSKMSSVYLKEIAKKKNDKKEAYVRDFTNIYWSQ
NRPDVKKQKLQNDKKTVEAENIFSKCYENDYPSLSSQNTCKRKDLISSNYCNCSSIQCNV
RDSRKNFAILENANWEEAECLDSYVLTRLEKSQNWDCNVRHILRRNRGNCWIINNCKTKC
ENMKKTEEKWNWLLLLEIDLLSKEDYHCAKVINAYEEQSKLLVREILGSQTALITTVWLN
GKGENDNTLQLRYNTTQKVFHVNNPFESFIIEIFYFHKSISGNKKDNSILTCCNILKCKK
QIGIIGIQNLITRNMNTNIKNGILSIYLQDSVSEPLDILLKTNIAFLLNNFDSLTRIEND
FELEEECIFKCMLYLKYPKNIVENHTAYLVKILTSSRLLEDNMKPMLKKRKLFRTEQVFE
KSKKKLINSFSMTTQNTGFPIFETYEKIPLLMDFDDMDEISLIREITCQNMSCPQQVVNV
ENWAHYNSSTVKAHGNSCPQFIQNNRGYINENFYEVNMHSQDLNMERKQGHNKISNFDCE
HIFEDLCNVRQQAIPASHNIIHNEETHTTSITQVLNFWNLLSEIEEKKYDLILKEEVKVT
AESLTNSCQVHKDTKIEKEEKDSFFPMDDMFSVQSVSLISKEVNVEENKYVNQNYVTNTN
EYESILPEREIANSKDFHRKNDSALYINHQFETGLSEGNDECFQDLAAKYLSTEALTIVK
DFEMKRKFDLVLEELRMFHEISRENELLSTVETNNGQENYFGENDAEKVKMEIEKDLKMV
VVNKIRASSSFHDTIAGPNMGKSHQSLFKWKTVPNNGEQEVPNESCYPSRSEEELLYSTS
EKDCETPLPKRPAFLPDECKEEFNYLLRGGSHFPHGISRVRPLKTCSRPIRIGLSRKARI
KQLHPYLKQMCYGNLKENF
NT seq 3480 nt NT seq  +upstreamnt  +downstreamnt
atgtctctccctcagcccacgccgcggatggccgagctcagaaagcctacctcctcttta
acgcctcctgaggacccggattcccaaccacctagtagcaagcggctctgtcttgaggag
cctggaggtgtctttaaggcgggctggcgactgcctctggtgcctcgcttgtctgaggcg
gaaaaagtctgggagttgtcccctagacccttcaagggactccttgtttcaacgaatgct
attttcgataactccacagactcgtgtgtggagaaatcagtcagtgggaagcagatatgt
aatctgaaatgctcaaatctcaaattccaaatgagtagctgtttgcagtctcccccctca
caaagtcctgattctgatttgagggcttcaggaaggtctgaggcaggcctgcatgacaga
gaggctttcagtgtgcaccgcagtaatagctccaaagcaggggttagtcaacttctgccc
agcacctctatacacgatatacatggaattagaaatgagaatcgaaaacaacagtttgtc
caaggaagagacaatgttcacaaagaaaatccatttttagatgttaccttttacaaggaa
actaaatcaccatttcatgaaattaagaacagatgtaaagctaacagtgttgtgccatca
aataaaagagaaaataacatttcatcatctgtactaaaaatatcaaaatctcaaaaccag
cccagcttggaaattgccaaacctagctattttagagatagcggcacaataagtgtccct
cagtttccaatggacttaaatagcaaaatgtcctctgtctatttaaaggaaatagcgaag
aaaaagaatgacaaaaaagaggcatatgttagggatttcacaaacatttactggtcccaa
aatagacctgatgttaagaagcaaaagttacagaatgataaaaaaactgtagaagcggaa
aacattttttccaaatgttatgaaaatgactacccatcactcagtagccaaaatacttgt
aagagaaaagacttgatcagttcaaactactgtaactgcagtagtatccagtgtaatgta
agagactctagaaagaatttcgctatactagaaaatgcaaattgggaggaagcagaatgt
ctggacagttacgtacttaccaggctggaaaaatctcaaaactgggactgtaacgttaga
catattttgagaagaaatagaggaaattgttggattataaataattgcaagactaaatgt
gaaaatatgaaaaaaactgaagaaaaatggaattggctattattattagaaatagacctt
ttaagcaaggaagattaccactgtgcaaaagtcatcaatgcatatgaagaacaatcaaag
cttctcgtaagagaaatattaggtagtcagacagctttaataacgactgtttggctaaat
ggtaaaggagaaaatgataatactctacagttgagatacaatactacacaaaaagtcttt
catgtgaacaacccttttgaaagtttcattatagaaattttttatttccataaaagtatt
tcaggaaataaaaaagataatagtattttaacctgctgtaacattttgaagtgtaaaaag
caaattggtataattggtattcaaaatctaataaccagaaacatgaatacaaatataaag
aatggaattttaagcatatatttacaagatagtgtttcagaacctttagatattctattg
aaaactaacatagcttttttgctcaataactttgactctttaacaagaattgaaaatgat
tttgaattagaagaggaatgcattttcaagtgcatgctttatttgaagtatccaaaaaat
atagtggaaaatcatactgcatatctagtaaagattttaacttcttcaagactattagaa
gataatatgaaacctatgttaaagaaaaggaagttatttagaactgaacaagtttttgaa
aagtctaagaaaaaactcattaattccttcagtatgacaactcaaaatacaggttttccg
atttttgaaacatatgaaaaaattccccttttaatggactttgatgacatggatgaaatt
tctttaataagagaaattacttgtcagaatatgagttgtcctcaacaagttgtgaatgtg
gaaaattgggctcactataattctagtactgttaaagcacatggtaattcttgtcctcaa
tttatacagaacaaccgaggatacattaatgaaaatttttatgaagtaaatatgcacagc
caagatttaaatatggaaagaaaacagggacataataagatcagtaactttgactgtgag
cacatatttgaagatctctgcaatgttaggcaacaggccataccagcaagccacaacata
atacataatgaagagacccataccacttctataactcaagtactaaatttttggaacttg
ctaagtgaaatagaagaaaaaaaatatgacttaattttgaaagaggaagtaaaagtcaca
gctgaaagtttaacaaatagttgccaagttcacaaagatactaagatagaaaaggaagag
aaagatagtttttttccaatggatgacatgttttctgtacagtcagtttcattaataagt
aaggaagtaaatgtggaagaaaataaatatgttaatcaaaattatgtaacaaatacaaat
gaatatgagagtattttgccagaaagggagatagctaattcaaaggattttcacagaaag
aatgactctgcattatatattaatcatcaatttgaaactggtctgagtgaagggaatgat
gaatgttttcaggacttagctgctaaatatttatcaacagaagctctgacaatagtaaaa
gattttgagatgaagagaaaatttgacttagtacttgaagaacttcgtatgtttcatgaa
attagtagggaaaatgaacttctaagcactgtggaaacaaacaatgggcaagaaaattac
tttggagaaaatgatgctgagaaggtaaaaatggagatagaaaaagatttgaaaatggtt
gtggtcaacaaaatacgtgcatcttcctcgttccatgatactatagcaggtcctaatatg
ggcaaaagtcaccaaagtttatttaaatggaaaactgtacccaataatggagaacaggaa
gttcctaatgagagttgttatccaagtagatcagaggaagaattactttactctacttct
gagaaagattgtgaaacacctttacctaaaagacctgcttttctccctgatgaatgtaaa
gaagaatttaattatttattgagaggaggtagtcactttccacatggcatttcaagagta
cgaccgcttaagacatgcagtaggccaatcaggattggtttgtcaagaaaagcaaggatt
aaacaacttcatccttatctgaaacaaatgtgttacggaaacttaaaagaaaatttttga

DBGET integrated database retrieval system