KEGG   Homo sapiens (human): 7447Help
Entry
7447              CDS       T01001                                 

Gene name
VSNL1, HLP3, HPCAL3, HUVISL1, VILIP, VILIP-1
Definition
(RefSeq) visinin like 1
  KO
K19936  visinin-like protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    7447 (VSNL1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    7447 (VSNL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg Dockerin_1 p25-alpha Caleosin IL3
Motif
Other DBs
NCBI-GeneID: 7447
NCBI-ProteinID: NP_003376
OMIM: 600817
HGNC: 12722
Ensembl: ENSG00000163032
Vega: OTTHUMG00000090645
Pharos: P62760(Tbio)
UniProt: P62760
Position
2p24.2
AA seq 191 aa AA seqDB search
MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGD
ASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVE
MLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPS
IVLLLQCDIQK
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggggaagcagaatagcaaactggcccctgaagtgatggaggacctggtgaagagcaca
gagtttaatgagcatgaactcaagcagtggtacaaaggatttctcaaggactgtccaagt
gggaggctaaatctcgaggaatttcagcagctctatgtgaagttctttccttatggagac
gcctccaagtttgcccagcatgccttccgaaccttcgacaagaatggggacggcaccatt
gacttccgagagttcatctgcgctctgtccatcacctccaggggcagctttgagcagaag
ctgaactgggccttcaatatgtatgacctggatggtgatggcaagatcacccgagtggag
atgctggagatcatcgaggctatctacaaaatggtaggcactgtgatcatgatgaaaatg
aatgaggatggcctgacgcctgagcagcgagtagacaagattttcagcaagatggataag
aacaaagatgaccagattacactggatgaattcaaagaagctgcaaagagcgacccttcc
attgtattacttctgcagtgcgacatccagaaatga

DBGET integrated database retrieval system