KEGG   Homo sapiens (human): 7903Help
Entry
7903              CDS       T01001                                 

Gene name
ST8SIA4, PST, PST1, SIAT8D, ST8SIA-IV
Definition
(RefSeq) ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4
  KO
K06614  alpha-N-acetyl-neuraminate alpha-2,8-sialyltransferase (sialyltransferase 8D) [EC:2.4.99.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    7903 (ST8SIA4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.-  
     7903 (ST8SIA4)
Glycosyltransferases [BR:hsa01003]
 Terminal extension
  Sialyltransferase
   7903 (ST8SIA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 7903
NCBI-ProteinID: NP_005659
OMIM: 602547
HGNC: 10871
Ensembl: ENSG00000113532
Vega: OTTHUMG00000128727
Pharos: Q92187(Tbio)
UniProt: Q92187
Structure
PDB: 

Position
5q21.1
AA seq 359 aa AA seqDB search
MRSIRKRWTICTISLLLIFYKTKEIARTEEHQETQLIGDGELSLSRSLVNSSDKIIRKAG
SSIFQHNVEGWKINSSLVLEIRKNILRFLDAERDVSVVKSSFKPGDVIHYVLDRRRTLNI
SHDLHSLLPEVSPMKNRRFKTCAVVGNSGILLDSECGKEIDSHNFVIRCNLAPVVEFAAD
VGTKSDFITMNPSVVQRAFGGFRNESDREKFVHRLSMLNDSVLWIPAFMVKGGEKHVEWV
NALILKNKLKVRTAYPSLRLIHAVRGYWLTNKVPIKRPSTGLLMYTLATRFCDEIHLYGF
WPFPKDLNGKAVKYHYYDDLKYRYFSNASPHRMPLEFKTLNVLHNRGALKLTTGKCVKQ
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcgctccattaggaagaggtggacgatctgcacaataagtctgctcctgatcttttat
aagacaaaagaaatagcaagaactgaggagcaccaggagacgcaactcatcggagatggt
gaattgtctttgagtcggtcacttgtcaatagctctgataaaatcattcgaaaggctggc
tcttcaatcttccagcacaatgtagaaggttggaaaatcaattcctctttggtcctagag
ataaggaagaacatacttcgtttcttagatgcagaacgagatgtgtcagtggtcaagagc
agttttaagcctggtgatgtcatacactatgtgcttgacaggcgccggacactaaacatt
tctcatgatctacatagcctcctacctgaagtttcaccaatgaagaatcgcaggtttaag
acctgtgcagttgttggaaattctggcattctgttagacagtgaatgtggaaaggagatt
gacagtcacaattttgtaataaggtgtaatctagctcctgtggtggagtttgctgcagat
gtgggaactaaatcagattttattaccatgaatccatcagttgtacaaagagcatttgga
ggctttcgaaatgagagtgacagagaaaaatttgtgcatagactttccatgctgaatgac
agtgtcctttggattcctgctttcatggtcaaaggaggagagaagcacgtggagtgggtt
aatgcattaatccttaagaataaactgaaagtgcgaactgcctatccgtcattgagactt
attcatgctgtcagaggttactggctgaccaacaaagttcctatcaaaagacccagcaca
ggtcttctcatgtatacacttgccacaagattctgtgatgaaattcacctgtatggattc
tggcccttccctaaggatttaaatggaaaagcggtcaaatatcattattatgatgactta
aaatataggtacttttccaatgcaagccctcacagaatgccattagaattcaaaacatta
aatgtgctacataatagaggagctctaaaactgacaacaggaaagtgtgtaaagcaataa

DBGET integrated database retrieval system