KEGG   Homo sapiens (human): 79065Help
Entry
79065             CDS       T01001                                 

Gene name
ATG9A, APG9L1, MGD3208, mATG9
Definition
(RefSeq) autophagy related 9A
  KO
K17907  autophagy-related protein 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa04136  Autophagy - other
hsa04137  Mitophagy - animal
hsa04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    79065 (ATG9A)
   04136 Autophagy - other
    79065 (ATG9A)
   04137 Mitophagy - animal
    79065 (ATG9A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    79065 (ATG9A)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    79065 (ATG9A)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    79065 (ATG9A)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   ATG9 transmembrane protein
    79065 (ATG9A)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    79065 (ATG9A)
Transporters [BR:hsa02000]
 Other Transporters
  Others
   79065 (ATG9A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: APG9 PRRSV_2b
Motif
Other DBs
NCBI-GeneID: 79065
NCBI-ProteinID: NP_001070666
OMIM: 612204
HGNC: 22408
Ensembl: ENSG00000198925
Vega: OTTHUMG00000154557
Pharos: Q7Z3C6(Tbio)
UniProt: Q7Z3C6 A0A024R438
Position
2q35
AA seq 839 aa AA seqDB search
MAQFDTEYQRLEASYSDSPPGEEDLLVHVAEGSKSPWHHIENLDLFFSRVYNLHQKNGFT
CMLIGEIFELMQFLFVVAFTTFLVSCVDYDILFANKMVNHSLHPTEPVKVTLPDAFLPAQ
VCSARIQENGSLITILVIAGVFWIHRLIKFIYNICCYWEIHSFYLHALRIPMSALPYCTW
QEVQARIVQTQKEHQICIHKRELTELDIYHRILRFQNYMVALVNKSLLPLRFRLPGLGEA
VFFTRGLKYNFELILFWGPGSLFLNEWSLKAEYKRGGQRLELAQRLSNRILWIGIANFLL
CPLILIWQILYAFFSYAEVLKREPGALGARCWSLYGRCYLRHFNELEHELQSRLNRGYKP
ASKYMNCFLSPLLTLLAKNGAFFAGSILAVLIALTIYDEDVLAVEHVLTTVTLLGVTVTV
CRSFIPDQHMVFCPEQLLRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFILEEL
LSPIVTPLILIFCLRPRALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQHGHPQWLSAGQT
EASVYQQAEDGKTELSLMHFAITNPGWQPPRESTAFLGFLKEQVQRDGAAASLAQGGLLP
ENALFTSIQSLQSESEPLSLIANVVAGSSCRGPPLPRDLQGSRHRAEVASALRSFSPLQP
GQAPTGRAHSTMTGSGVDARTASSGSSVWEGQLQSLVLSEYASTEMSLHALYMHQLHKQQ
AQAEPERHVWHRRESDESGESAPDEGGEGARAPQSIPRSASYPCAAPRPGAPETTALHGG
FQRRYGGITDPGTVPRVPSHFSRLPLGGWAEDGQSASRHPEPVPEEGSEDELPPQVHKV
NT seq 2520 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagtttgacactgaataccagcgcctagaggcctcctatagtgattcaccccca
ggggaggaggacctgttggtgcacgtcgccgaggggagcaagtcaccttggcaccatatt
gaaaaccttgacctcttcttctctcgagtttataatctgcaccagaagaatggcttcaca
tgtatgctcatcggggagatctttgagctcatgcagttcctctttgtggttgccttcact
accttcctggtcagctgcgtggactatgacatcctatttgccaacaagatggtgaaccac
agtcttcaccctactgaacccgtcaaggtcactctgccagacgcctttttgcctgctcaa
gtctgtagtgccaggattcaggaaaatggctcccttatcaccatcctggtcattgctggt
gtcttctggatccaccggcttatcaagttcatctataacatttgctgctactgggagatc
cactccttctacctgcacgctctgcgcatccctatgtctgcccttccgtattgcacgtgg
caagaagtgcaggcccggatcgtgcagacgcagaaggagcaccagatctgcatccacaaa
cgtgagctgacagaactggacatctaccaccgcatcctccgtttccagaactacatggtg
gcactggttaacaaatccctcctgcctctgcgcttccgcctgcctggcctcggggaagct
gtcttcttcacccgtggtctcaagtacaactttgagctgatcctcttctggggacctggc
tctctgtttctcaatgaatggagcctcaaggccgagtacaaacgtggggggcaacggcta
gagctggcccagcgcctcagcaaccgcatcctgtggattggcatcgctaacttcctgctg
tgccccctcatcctcatatggcaaatcctctatgccttcttcagctatgctgaggtgctg
aagcgggagccgggggccctgggagcacgctgctggtcactctatggccgctgctacctc
cgccacttcaacgagctggagcacgagctgcagtcccgcctcaaccgtggctacaagccc
gcctccaagtacatgaattgcttcttgtcacctcttttgacactgctggccaagaatgga
gccttcttcgctggctccatcctggctgtgcttattgccctcaccatttatgacgaagat
gtgttggctgtggaacatgtgctgaccaccgtcacactcctgggggtcaccgtgaccgtg
tgcaggtcctttatcccggaccagcacatggtgttctgccctgagcagctgctccgcgtg
atcctcgctcacatccactacatgcctgaccactggcagggtaatgcccaccgctcgcag
acccgggacgagtttgcccagctcttccagtacaaggcagtgttcattttggaagagttg
ctgagccccattgtcacacccctcatcctcatcttctgcctgcgcccacgggccctggag
attatagacttcttccgaaacttcaccgtggaggtcgttggtgtgggagatacctgctcc
tttgctcagatggatgttcgccagcatggtcatccccagtggctatctgctgggcagaca
gaggcctcagtgtaccagcaagctgaggatggaaagacagagttgtcactcatgcacttt
gccatcaccaaccctggctggcagccaccacgtgagagcacagccttcctaggcttcctc
aaggagcaggttcagcgggatggagcagctgctagcctcgcccaagggggtctgctccct
gaaaatgccctctttacgtctatccagtccttacaatctgagtctgagcccctgagcctt
atcgcaaatgtggtagctggctcatcctgccggggccctccactgcccagagacctgcag
ggctccaggcacagggctgaagtcgcctctgccctgcgctccttctccccgctgcaaccc
gggcaggcgcccacaggccgggctcacagcaccatgacaggctctggggtggatgccagg
acagccagctccgggagcagcgtgtgggaaggacagctgcagagcctggtgctgtcagaa
tatgcatccacagagatgagcctgcatgccctctatatgcaccagctccacaagcagcag
gcccaggctgaacctgagcggcatgtatggcaccgccgggagagtgatgagagtggagaa
agcgcccctgatgaagggggagagggcgcccgggccccccagtctatccctcgctctgct
agctatccctgtgcagcaccccggcctggagctcctgagaccactgccctgcatgggggc
ttccagaggcgctacggtggcatcacagatcctggcacagtgcccagggttccctctcat
ttctctcggctgcctcttggagggtgggcagaagatgggcagtcggcatcaaggcaccct
gagcccgtgcccgaagagggctcggaggatgagctaccccctcaggtgcacaaggtatag

DBGET integrated database retrieval system