KEGG   Homo sapiens (human): 79677Help
Entry
79677             CDS       T01001                                 

Gene name
SMC6, SMC-6, SMC6L1, hSMC6
Definition
(RefSeq) structural maintenance of chromosomes 6
  KO
K22804  structural maintenance of chromosomes protein 6
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    79677 (SMC6)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    SMC5-SMC6 complex
     79677 (SMC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SMC_N AAA_23 AAA_15 AAA_21 TPR_MLP1_2 AAA_29 DUF3993 DUF5082
Motif
Other DBs
NCBI-GeneID: 79677
NCBI-ProteinID: NP_001135758
OMIM: 609387
HGNC: 20466
Ensembl: ENSG00000163029
Vega: OTTHUMG00000090675
Pharos: Q96SB8(Tbio)
UniProt: Q96SB8 A0A2S1ZR87
Position
2p24.2
AA seq 1091 aa AA seqDB search
MAKRKEENFSSPKNAKRPRQEELEDFDKDGDEDECKGTTLTAAEVGIIESIHLKNFMCHS
MLGPFKFGSNVNFVVGNNGSGKSAVLTALIVGLGGRAVATNRGSSLKGFVKDGQNSADIS
ITLRNRGDDAFKASVYGNSILIQQHISIDGSRSYKLKSATGSVVSTRKEELIAILDHFNI
QVDNPVSVLTQEMSKQFLQSKNEGDKYKFFMKATQLEQMKEDYSYIMETKERTKEQIHQG
EERLTELKRQCVEKEERFQSIAGLSTMKTNLESLKHEMAWAVVNEIEKQLNAIRDNIKIG
EDRAARLDRKMEEQQVRLNEAEQKYKDIQDKLEKISEETNARAPECMALKADVVAKKRAY
NEAEVLYNRSLNEYKALKKDDEQLCKRIEELKKSTDQSLEPERLERQKKISWLKERVKAF
QNQENSVNQEIEQFQQAIEKDKEEHGKIKREELDVKHALSYNQRQLKELKDSKTDRLKRF
GPNVPALLEAIDDAYRQGHFTYKPVGPLGACIHLRDPELALAIESCLKGLLQAYCCHNHA
DERVLQALMKRFYLPGTSRPPIIVSEFRNEIYDVRHRAAYHPDFPTVLTALEIDNAVVAN
SLIDMRGIETVLLIKNNSVARAVMQSQKPPKNCREAFTADGDQVFAGRYYSSENTRPKFL
SRDVDSEISDLENEVENKTAQILNLQQHLSALEKDIKHNEELLKRCQLHYKELKMKIRKN
ISEIRELENIEEHQSVDIATLEDEAQENKSKMKMVEEHMEQQKENMEHLKSLKIEAENKY
DAIKFKINQLSELADPLKDELNLADSEVDNQKRGKRHYEEKQKEHLDTLNKKKRELDMKE
KELEEKMSQARQICPERIEVEKSASILDKEINRLRQKIQAEHASHGDREEIMRQYQEARE
TYLDLDSKVRTLKKFIKLLGEIMEHRFKTYQQFRRCLTLRCKLYFDNLLSQRAYCGKMNF
DHKNETLSISVQPGEGNKAAFNDMRALSGGERSFSTVCFILSLWSIAESPFRCLDEFDVY
MDMVNRRIAMDLILKMADSQRFRQFILLTPQSMSSLPSSKLIRILRMSDPERGQTTLPFR
PVTQEEDDDQR
NT seq 3276 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaagaaaggaagaaaatttttcctctcctaaaaatgccaaaaggccaagacaa
gaagaattggaggattttgataaagatggtgacgaagacgaatgtaaaggtactactttg
actgcagcagaagttggaataattgagagtattcacctaaaaaacttcatgtgtcattca
atgcttggaccttttaagtttggttctaatgtcaactttgttgttggcaacaatggaagt
gggaagagtgcagtactcacagctctcatagtcggtcttggtggaagagcagttgctact
aatagaggatcctctttaaaaggttttgtgaaagatggacagaactctgcagatatctca
ataacattgaggaacagaggagatgatgcctttaaagccagtgtgtatggtaactctata
cttatacagcaacacatcagcatagatggaagtcgatcttataaacttaaaagtgcaaca
ggctccgtggtttccacgaggaaagaagagctgattgcaattcttgatcattttaacatc
caggtggataatccagtttctgttttaacacaagaaatgagcaagcagttcttacagtct
aaaaatgaaggagacaaatacaaattcttcatgaaagcaacgcaacttgaacagatgaag
gaagattattcatacattatggaaacgaaagaaagaacaaaggagcagatacatcaagga
gaagagcggcttactgaactaaagcgccagtgtgtagagaaagaggaacgttttcaaagt
attgctggtttaagtacaatgaagactaatttagagtccttgaaacatgaaatggcttgg
gcagtggtcaatgaaattgaaaaacaattgaatgccatcagagataatatcaaaattgga
gaagatcgtgctgctagacttgacaggaaaatggaagaacagcaggtcagacttaatgag
gcagaacaaaagtacaaggatattcaagacaaactagaaaagattagtgaagagacaaat
gcacgagcaccagaatgtatggcattgaaagcagatgttgttgctaagaaaagggcctat
aatgaagctgaggttttatataaccgatccttaaacgaatataaagcattaaagaaagat
gatgagcagctttgtaaacgaattgaagagctgaaaaaaagtactgaccaatctttggaa
cctgaacggttggaaagacaaaaaaaaatatcttggttaaaagagagagtaaaggccttt
caaaatcaagaaaattcagtcaatcaagagatcgaacagtttcagcaagccatagaaaag
gacaaagaagaacatggcaaaattaagagagaagaattagatgtgaagcatgcactgagc
tacaatcagaggcaactgaaagaattgaaagatagtaaaactgatcgactcaaaagattt
ggccctaatgttccagctcttcttgaagccatagatgatgcttatagacaaggacatttt
acctataaacctgtaggccctttaggagcttgcattcatcttcgggacccagaacttgct
ttggctattgaatcttgcttaaaagggcttctgcaggcctattgttgccataatcatgct
gatgaaagggtccttcaggcactcatgaaaaggttttatttaccagggacctcacggcca
ccgataatagtttctgagtttcggaatgagatatatgatgtaagacacagagctgcttat
catccagactttccaacagttctgacagctttagaaatagataatgcggttgtggcaaat
agcctaattgacatgagaggcatagagacagtgctactaatcaaaaataattctgtagct
cgtgcagtaatgcagtcccaaaagccacccaaaaattgtagagaagcttttactgctgat
ggtgatcaagtttttgcaggacgttattattcatctgaaaatacaagacctaagttccta
agcagagatgtggattctgaaataagtgacttggagaatgaggttgaaaataagacggcc
cagatattaaatcttcagcaacatttatctgcccttgaaaaagatattaaacacaatgag
gaacttcttaaaaggtgccaactacattataaagaactaaagatgaaaataagaaaaaat
atttctgaaattcgggaacttgagaacatagaagaacaccagtctgtagatattgcaact
ttggaagatgaagctcaggaaaataaaagcaaaatgaaaatggttgaggaacatatggag
caacaaaaagaaaatatggagcatcttaaaagtctgaaaatagaagcagaaaataagtat
gatgcaattaaattcaaaattaatcaactatcggagctagcagacccacttaaggatgaa
ttaaaccttgctgattctgaagtggataaccaaaaacgagggaaacgacattatgaagaa
aaacaaaaagaacacttggataccttaaataaaaagaaacgagaactggatatgaaagag
aaagaactagaggagaaaatgtcacaagcaagacaaatctgcccagagcgtatagaagta
gaaaaatctgcatcaattctggacaaagaaattaatcgattaaggcagaagatacaggca
gaacatgctagtcatggagatcgagaggaaataatgaggcagtaccaagaagcaagagag
acctatcttgatctggatagtaaagtgaggactttaaaaaagtttattaaattactggga
gaaatcatggagcacagattcaagacatatcaacaatttagaaggtgtttgactttacga
tgcaaattatactttgacaacttactatctcagcgggcctattgtggaaaaatgaatttt
gaccacaagaatgaaactctaagtatatcagttcagcctggagaaggaaataaagctgct
ttcaatgacatgagagccttgtctggaggtgaacgttctttctccacagtgtgttttatt
ctttccctgtggtccatcgcagaatctcctttcagatgcctggatgaatttgatgtctac
atggatatggttaataggagaattgccatggacttgatactgaagatggcagattcccag
cgttttagacagtttatcttgctcacacctcaaagcatgagttcacttccatccagtaaa
ctgataagaattctccgaatgtctgatcctgaaagaggacaaactacattgcctttcaga
cctgtgactcaagaagaagatgatgaccaaaggtga

DBGET integrated database retrieval system