KEGG   Homo sapiens (human): 79987
Entry
79987             CDS       T01001                                 
Symbol
SVEP1, C9orf13, CCP22, POLYDOM, SEL-OB, SELOB
Name
(RefSeq) sushi, von Willebrand factor type A, EGF and pentraxin domain containing 1
  KO
K24469  sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    79987 (SVEP1)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 EGF-like domain-containing proteins
  hEGF domain-containing proteins
   79987 (SVEP1)
SSDB
Motif
Pfam: Sushi Ephrin_rec_like EGF VWA HYR hEGF Pentaxin Laminin_G_3 EGF_2 VWA_2 EGF_CA EGF_3 DUF1737 Laminin_G_2 DUF4625
Other DBs
NCBI-GeneID: 79987
NCBI-ProteinID: NP_699197
OMIM: 611691
HGNC: 15985
Ensembl: ENSG00000165124
Vega: OTTHUMG00000020482
Pharos: Q4LDE5(Tbio)
UniProt: Q4LDE5 Q5JB40 B3KQM1
Position
9:complement(110365248..110579741)
AA seq 3571 aa
MWPRLAFCCWGLALVSGWATFQQMSPSRNFSFRLFPETAPGAPGSIPAPPAPGDEAAGSR
VERLGQAFRRRVRLLRELSERLELVFLVDDSSSVGEVNFRSELMFVRKLLSDFPVVPTAT
RVAIVTFSSKNYVVPRVDYISTRRARQHKCALLLQEIPAISYRGGGTYTKGAFQQAAQIL
LHARENSTKVVFLITDGYSNGGDPRPIAASLRDSGVEIFTFGIWQGNIRELNDMASTPKE
EHCYLLHSFEEFEALARRALHEDLPSGSFIQDDMVHCSYLCDEGKDCCDRMGSCKCGTHT
GHFECICEKGYYGKGLQYECTACPSGTYKPEGSPGGISSCIPCPDENHTSPPGSTSPEDC
VCREGYRASGQTCELVHCPALKPPENGYFIQNTCNNHFNAACGVRCHPGFDLVGSSIILC
LPNGLWSGSESYCRVRTCPHLRQPKHGHISCSTREMLYKTTCLVACDEGYRLEGSDKLTC
QGNSQWDGPEPRCVERHCSTFQMPKDVIISPHNCGKQPAKFGTICYVSCRQGFILSGVKE
MLRCTTSGKWNVGVQAAVCKDVEAPQINCPKDIEAKTLEQQDSANVTWQIPTAKDNSGEK
VSVHVHPAFTPPYLFPIGDVAIVYTATDLSGNQASCIFHIKVIDAEPPVIDWCRSPPPVQ
VSEKVHAASWDEPQFSDNSGAELVITRSHTQGDLFPQGETIVQYTATDPSGNNRTCDIHI
VIKGSPCEIPFTPVNGDFICTPDNTGVNCTLTCLEGYDFTEGSTDKYYCAYEDGVWKPTY
TTEWPDCAKKRFANHGFKSFEMFYKAARCDDTDLMKKFSEAFETTLGKMVPSFCSDAEDI
DCRLEENLTKKYCLEYNYDYENGFAIGPGGWGAANRLDYSYDDFLDTVQETATSIGNAKS
SRIKRSAPLSDYKIKLIFNITASVPLPDERNDTLEWENQQRLLQTLETITNKLKRTLNKD
PMYSFQLASEILIADSNSLETKKASPFCRPGSVLRGRMCVNCPLGTYYNLEHFTCESCRI
GSYQDEEGQLECKLCPSGMYTEYIHSRNISDCKAQCKQGTYSYSGLETCESCPLGTYQPK
FGSRSCLSCPENTSTVKRGAVNISACGVPCPEGKFSRSGLMPCHPCPRDYYQPNAGKAFC
LACPFYGTTPFAGSRSITECSSFSSTFSAAEESVVPPASLGHIKKRHEISSQVFHECFFN
PCHNSGTCQQLGRGYVCLCPLGYTGLKCETDIDECSPLPCLNNGVCKDLVGEFICECPSG
YTGQRCEENINECSSSPCLNKGICVDGVAGYRCTCVKGFVGLHCETEVNECQSNPCLNNA
VCEDQVGGFLCKCPPGFLGTRCGKNVDECLSQPCKNGATCKDGANSFRCLCAAGFTGSHC
ELNINECQSNPCRNQATCVDELNSYSCKCQPGFSGKRCETEQSTGFNLDFEVSGIYGYVM
LDGMLPSLHALTCTFWMKSSDDMNYGTPISYAVDNGSDNTLLLTDYNGWVLYVNGREKIT
NCPSVNDGRWHHIAITWTSANGIWKVYIDGKLSDGGAGLSVGLPIPGGGALVLGQEQDKK
GEGFSPAESFVGSISQLNLWDYVLSPQQVKSLATSCPEELSKGNVLAWPDFLSGIVGKVK
IDSKSIFCSDCPRLGGSVPHLRTASEDLKPGSKVNLFCDPGFQLVGNPVQYCLNQGQWTQ
PLPHCERISCGVPPPLENGFHSADDFYAGSTVTYQCNNGYYLLGDSRMFCTDNGSWNGVS
PSCLDVDECAVGSDCSEHASCLNVDGSYICSCVPPYTGDGKNCAEPIKCKAPGNPENGHS
SGEIYTVGAEVTFSCQEGYQLMGVTKITCLESGEWNHLIPYCKAVSCGKPAIPENGCIEE
LAFTFGSKVTYRCNKGYTLAGDKESSCLANSSWSHSPPVCEPVKCSSPENINNGKYILSG
LTYLSTASYSCDTGYSLQGPSIIECTASGIWDRAPPACHLVFCGEPPAIKDAVITGNNFT
FRNTVTYTCKEGYTLAGLDTIECLADGKWSRSDQQCLAVSCDEPPIVDHASPETAHRLFG
DIAFYYCSDGYSLADNSQLLCNAQGKWVPPEGQDMPRCIAHFCEKPPSVSYSILESVSKA
KFAAGSVVSFKCMEGFVLNTSAKIECMRGGQWNPSPMSIQCIPVRCGEPPSIMNGYASGS
NYSFGAMVAYSCNKGFYIKGEKKSTCEATGQWSSPIPTCHPVSCGEPPKVENGFLEHTTG
RIFESEVRYQCNPGYKSVGSPVFVCQANRHWHSESPLMCVPLDCGKPPPIQNGFMKGENF
EVGSKVQFFCNEGYELVGDSSWTCQKSGKWNKKSNPKCMPAKCPEPPLLENQLVLKELTT
EVGVVTFSCKEGHVLQGPSVLKCLPSQQWNDSFPVCKIVLCTPPPLISFGVPIPSSALHF
GSTVKYSCVGGFFLRGNSTTLCQPDGTWSSPLPECVPVECPQPEEIPNGIIDVQGLAYLS
TALYTCKPGFELVGNTTTLCGENGHWLGGKPTCKAIECLKPKEILNGKFSYTDLHYGQTV
TYSCNRGFRLEGPSALTCLETGDWDVDAPSCNAIHCDSPQPIENGFVEGADYSYGAIIIY
SCFPGFQVAGHAMQTCEESGWSSSIPTCMPIDCGLPPHIDFGDCTKLKDDQGYFEQEDDM
MEVPYVTPHPPYHLGAVAKTWENTKESPATHSSNFLYGTMVSYTCNPGYELLGNPVLICQ
EDGTWNGSAPSCISIECDLPTAPENGFLRFTETSMGSAVQYSCKPGHILAGSDLRLCLEN
RKWSGASPRCEAISCKKPNPVMNGSIKGSNYTYLSTLYYECDPGYVLNGTERRTCQDDKN
WDEDEPICIPVDCSSPPVSANGQVRGDEYTFQKEIEYTCNEGFLLEGARSRVCLANGSWS
GATPDCVPVRCATPPQLANGVTEGLDYGFMKEVTFHCHEGYILHGAPKLTCQSDGNWDAE
IPLCKPVNCGPPEDLAHGFPNGFSFIHGGHIQYQCFPGYKLHGNSSRRCLSNGSWSGSSP
SCLPCRCSTPVIEYGTVNGTDFDCGKAARIQCFKGFKLLGLSEITCEADGQWSSGFPHCE
HTSCGSLPMIPNAFISETSSWKENVITYSCRSGYVIQGSSDLICTEKGVWSQPYPVCEPL
SCGSPPSVANAVATGEAHTYESEVKLRCLEGYTMDTDTDTFTCQKDGRWFPERISCSPKK
CPLPENITHILVHGDDFSVNRQVSVSCAEGYTFEGVNISVCQLDGTWEPPFSDESCSPVS
CGKPESPEHGFVVGSKYTFESTIIYQCEPGYELEGNRERVCQENRQWSGGVAICKETRCE
TPLEFLNGKADIENRTTGPNVVYSCNRGYSLEGPSEAHCTENGTWSHPVPLCKPNPCPVP
FVIPENALLSEKEFYVDQNVSIKCREGFLLQGHGIITCNPDETWTQTSAKCEKISCGPPA
HVENAIARGVHYQYGDMITYSCYSGYMLEGFLRSVCLENGTWTSPPICRAVCRFPCQNGG
ICQRPNACSCPEGWMGRLCEEPICILPCLNGGRCVAPYQCDCPPGWTGSRCHTAVCQSPC
LNGGKCVRPNRCHCLSSWTGHNCSRKRRTGF
NT seq 10716 nt   +upstreamnt  +downstreamnt
atgtggcctcgcctggccttttgttgctggggtctggcgctcgtttcgggctgggcgacc
tttcagcagatgtccccgtcgcgcaatttcagcttccgcctcttccccgagaccgcgccc
ggggcccccgggagtatccccgcgccgcccgctcctggcgacgaagcggcggggagcaga
gtggagcggctgggccaggcgttccggcgacgcgtgcggctgctgcgggagctcagcgag
cgcctggagcttgtcttcctggtggatgattcgtccagcgtgggcgaagtcaacttccgc
agcgagctcatgttcgtccgcaagctgctgtccgacttccccgtggtgcccacggccacg
cgcgtggccatcgtgaccttctcgtccaagaactacgtggtgccgcgcgtcgattacatc
tccacccgccgcgcgcgccagcacaagtgcgcgctgctcctccaagagatccctgccatc
tcctaccgaggtggcggcacctacaccaagggcgccttccagcaagccgcgcaaattctt
cttcatgctagagaaaactcaacaaaagttgtatttctcatcactgatggatattccaat
gggggagaccctagaccaattgcagcgtcactgcgagattcaggagtggagatcttcact
tttggcatatggcaagggaacattcgagagctgaatgacatggcttccaccccaaaggag
gagcactgttacctgctacacagttttgaagaatttgaggctttagctcgccgggcattg
catgaagatctaccttctgggagttttattcaagatgatatggtccactgctcatatctt
tgtgatgaaggcaaggactgctgtgaccgaatgggaagctgcaaatgtgggacacacaca
ggccattttgagtgcatctgtgaaaaggggtattacgggaaaggtctgcagtatgaatgc
acagcttgcccatcggggacatacaaacctgaaggctcaccaggaggaatcagcagttgc
attccatgtcctgatgaaaatcacacctctccacctggaagcacatcccctgaagactgt
gtctgcagagagggatacagggcatctggccagacctgtgaacttgtccactgccctgcc
ctgaagcctcccgaaaatggttactttatccaaaacacttgcaacaaccacttcaatgca
gcctgtggggtccgatgtcaccctggatttgatcttgtgggaagcagcatcatcttatgt
ctacccaatggtttgtggtccggttcagagagctactgcagagtaagaacatgtcctcat
ctccgccagccgaaacatggccacatcagctgttctacaagggaaatgttatataagaca
acatgtttggttgcctgtgatgaagggtacagactagaaggcagtgataagcttacttgt
caaggaaacagccagtgggatgggccagaaccccggtgtgtggagcgccactgttccacc
tttcagatgcccaaagatgtcatcatatccccccacaactgtggcaagcagccagccaaa
tttgggacgatctgctatgtaagttgccgccaagggttcattttatctggagtcaaagaa
atgctgagatgtaccacttctggaaaatggaatgtcggagttcaggcagctgtgtgtaaa
gacgtggaggctcctcaaatcaactgtcctaaggacatagaggctaagactctggaacag
caagattctgccaatgttacctggcagattccaacagctaaagacaactctggtgaaaag
gtgtcagtccacgttcatccagctttcaccccaccttaccttttcccaattggagatgtt
gctatcgtatacacggcaactgacctatccggcaaccaggccagctgcattttccatatc
aaggttattgatgcagaaccacctgtcatagactggtgcagatctccacctcccgtccag
gtctcggagaaggtacatgccgcaagctgggatgagcctcagttctcagacaactcaggg
gctgaattggtcattaccagaagtcatacacaaggagaccttttccctcaaggggagact
atagtacagtatacagccactgacccctcaggcaataacaggacatgtgatatccatatt
gtcataaaaggttctccctgtgaaattccattcacacctgtaaatggggattttatatgc
actccagataatactggagtcaactgtacattaacttgcttggagggctatgatttcaca
gaagggtctactgacaagtattattgtgcttatgaagatggcgtctggaaaccaacatat
accactgaatggccagactgtgccaaaaaacgttttgcaaaccacgggttcaagtccttt
gagatgttctacaaagcagctcgttgtgatgacacagatctgatgaagaagttttctgaa
gcatttgagacgaccctgggaaaaatggtcccatcattttgtagtgatgcagaggacatt
gactgcagactggaggagaacctgaccaaaaaatattgcctagaatataattatgactat
gaaaatggctttgcaattggaccaggtggctggggtgcagctaataggctggattactct
tacgatgacttcctggacactgtgcaagaaacagccacaagcatcggcaatgccaagtcc
tcacggattaaaagaagtgccccattatctgactataaaattaagttaatttttaacatc
acagctagtgtgccattacccgatgaaagaaatgatacccttgaatgggaaaatcagcaa
cgactccttcagacattggaaactatcacaaataaactgaaaaggactctcaacaaagac
cccatgtattcctttcagcttgcatcagaaatacttatagccgacagcaattcattagaa
acaaaaaaggcttcccccttctgcagaccaggctcagtgctgagagggcgtatgtgtgtc
aattgccctttgggaacctattataatctggaacatttcacctgtgaaagctgccggatc
ggatcctatcaagatgaagaagggcaacttgagtgcaagctttgcccctctgggatgtac
acggaatatatccattcaagaaacatctctgattgtaaagctcagtgtaaacaaggcacc
tactcatacagtggacttgagacttgtgaatcgtgtccactgggcacttatcagccaaaa
tttggttcccggagctgcctctcgtgtccagaaaacacctcaactgtgaaaagaggagcc
gtgaacatttctgcatgtggagttccttgtccagaaggaaaattctcgcgttctgggtta
atgccctgtcacccatgtcctcgtgactattaccaacctaatgcagggaaggccttctgc
ctggcctgtcccttttatggaactaccccattcgctggttccagatccatcacagaatgt
tcaagttttagttcaactttctcagcggcagaggaaagtgtggtgccccctgcctctctt
ggacatattaaaaagaggcatgaaatcagcagtcaggttttccatgaatgcttctttaac
ccttgccacaatagtggaacctgccagcaacttgggcgtggttatgtttgtctctgtcca
cttggatatacaggcttaaagtgtgaaacagacatcgatgagtgcagcccactgccttgc
ctcaacaatggagtttgtaaagacctagttggggaattcatttgtgagtgcccatcaggt
tacacaggtcagcggtgtgaagaaaatataaatgagtgtagctccagtccttgtttaaat
aaaggaatctgtgttgatggtgtggctggctatcgttgcacatgtgtgaaaggatttgta
ggcctgcattgtgaaacagaagtcaatgaatgccagtcaaacccatgcttaaataatgca
gtctgtgaagaccaggttgggggattcttgtgcaaatgcccacctggatttttgggtacc
cgatgtggaaagaacgtcgatgagtgtctcagtcagccatgcaaaaatggagctacctgt
aaagacggtgccaatagcttcagatgcctgtgtgcagctggcttcacaggatcacactgt
gaattgaacatcaatgaatgtcagtctaatccatgtagaaatcaggccacctgtgtggat
gaattaaattcatacagttgtaaatgtcagccaggattttcaggcaaaaggtgtgaaaca
gaacagtctacaggctttaacctggattttgaagtttctggcatctatggatatgtcatg
ctagatggcatgctcccatctctccatgctctaacctgtaccttctggatgaaatcctct
gacgacatgaactatggaacaccaatctcctatgcagttgataacggcagcgacaatacc
ttgctcctgactgattataacggctgggttctttatgtgaatggcagggaaaagataaca
aactgtccctcggtgaatgatggcagatggcatcatattgcaatcacttggacaagtgcc
aatggcatctggaaagtctatatcgatgggaaattatctgacggtggtgctggcctctct
gttggtttgcccatacctggtggtggtgcgttagttctggggcaagagcaagacaaaaaa
ggagagggattcagcccagctgagtcttttgtgggctccataagccagctcaacctctgg
gactatgtcctgtctccacagcaggtgaagtcactggctacctcctgcccagaggaactc
agtaaaggaaacgtgttagcatggcctgatttcttgtcaggaattgtggggaaagtgaag
atcgattctaagagcatattttgttctgattgcccacgcttaggagggtcagtgcctcat
ctgagaactgcatctgaagatttaaagccaggttccaaagtcaatctgttctgtgatcca
ggcttccagctggtcgggaaccctgtgcagtactgtctgaatcaaggacagtggacacaa
ccacttcctcactgtgaacgcattagctgtggggtgccacctcctttggagaatggcttc
cattcagccgatgacttctatgctggcagcacagtaacctaccagtgcaacaatggctac
tatctattgggtgactcaaggatgttctgtacagataatgggagctggaacggcgtttca
ccatcctgccttgatgtcgatgagtgtgcagttggatcagattgtagtgagcatgcttct
tgcctgaacgtagatggatcctacatatgttcatgtgtcccaccgtacacaggagatggg
aaaaactgtgcagaacctataaaatgtaaggctccaggaaatccggaaaatggccactcc
tcaggtgagatttatacagtaggtgccgaagtcacattttcgtgtcaggaaggataccag
ttgatgggagtaaccaaaatcacatgtttggagtctggagaatggaatcatctaatacca
tattgtaaagctgtttcatgtggtaaaccggctattccagaaaatggttgcattgaggag
ttagcatttacttttggcagcaaagtgacatataggtgtaataaaggatatactctggcc
ggtgataaagaatcatcctgtcttgctaacagttcttggagtcattcccctcctgtgtgt
gaaccagtgaagtgttctagtccggaaaatataaataatggaaaatatattttgagtggg
cttacctacctttctactgcatcatattcatgcgatacaggatacagcttacagggccct
tccattattgaatgcacggcttctggcatctgggacagagcgccacctgcctgtcacctc
gtcttctgtggagaaccacctgccatcaaagatgctgtcattacggggaataacttcact
ttcaggaacaccgtcacttacacttgcaaagaaggctatactcttgctggtcttgacacc
attgaatgcctggccgacggcaagtggagtagaagtgaccagcagtgcctggctgtctcc
tgtgatgagccacccattgtggaccacgcctctccagagactgcccatcggctctttgga
gacattgcattctactactgctctgatggttacagcctagcagacaattcccagcttctc
tgcaatgcccagggcaagtgggtacccccagaaggtcaagacatgccccgttgtatagct
catttctgtgaaaaacctccatcggtttcctatagcatcttggaatctgtgagcaaagca
aaatttgcagctggctcagttgtgagctttaaatgcatggaaggctttgtactgaacacc
tcagcaaagattgaatgtatgagaggtgggcagtggaacccttcccccatgtccatccag
tgcatccctgtgcggtgtggagagccaccaagcatcatgaatggctatgcaagtggatca
aactacagttttggagccatggtggcttacagctgcaacaaggggttctacatcaaaggg
gaaaagaagagcacctgcgaagccacagggcagtggagtagtcctataccgacgtgccac
ccggtatcttgtggtgaaccacctaaggttgagaatggctttctggagcatacaactggc
aggatctttgagagtgaagtgaggtatcagtgtaacccgggctataagtcagtcggaagt
cctgtatttgtctgccaagccaatcgccactggcacagtgaatcccctctgatgtgtgtt
cctctcgactgtggaaaacctcccccgatccagaatggcttcatgaaaggagaaaacttt
gaagtagggtccaaggttcagtttttctgtaatgagggttatgagcttgttggtgacagt
tcttggacatgtcagaaatctggcaaatggaataagaagtcaaatccaaagtgcatgcct
gccaagtgcccagagccgcccctcttggaaaaccagctagtattaaaggagttgaccacc
gaggtaggagttgtgacattttcctgtaaagaagggcatgtcctgcaaggcccctctgtc
ctgaaatgcttgccatcccagcaatggaatgactctttccctgtttgtaagattgttctt
tgtaccccacctcccctaatttcctttggtgtccccattccttcttctgctcttcatttt
ggaagtactgtcaagtattcttgtgtaggtgggtttttcctaagaggaaattctaccacc
ctctgccaacctgatggcacctggagctctccactgccagaatgtgttccagtagaatgt
ccccaacctgaggaaatccccaatggaatcattgatgtgcaaggccttgcctatctcagc
acagctctctatacctgcaagccaggctttgaattggtgggaaatactaccaccctttgt
ggagaaaatggtcactggcttggaggaaaaccaacatgtaaagccattgagtgcctgaaa
cccaaggagattttgaatggcaaattctcttacacggacctacactatggacagaccgtt
acctactcttgcaaccgaggctttcggctcgaaggtcccagtgccttgacctgtttagag
acaggtgattgggatgtagatgccccatcttgcaatgccatccactgtgattccccacaa
cccattgaaaatggttttgtagaaggtgcagattacagctatggtgccataatcatctac
agttgcttccctgggtttcaggtggctggtcatgccatgcagacctgtgaagagtcagga
tggtcaagttccatcccaacatgtatgccaatagactgtggcctccctcctcatatagat
tttggagactgtactaaactcaaagatgaccagggatattttgagcaagaagacgacatg
atggaagttccatatgtgactcctcaccctccttatcatttgggagcagtggctaaaacc
tgggaaaatacaaaggagtctcctgctacacattcatcaaactttctgtatggtaccatg
gtttcatacacctgtaatccaggatatgaacttctggggaaccctgtgctgatctgccag
gaagatggaacttggaatggcagtgcaccatcctgcatttcaattgaatgtgacttgcct
actgctcctgaaaatggctttttgcgttttacagagactagcatgggaagtgctgtgcag
tatagctgtaaacctggacacattctagcaggctctgacttaaggctttgtctagagaat
agaaagtggagtggtgcctccccacgctgtgaagccatttcatgcaaaaagccaaatcca
gtcatgaatggatccatcaaaggaagcaactacacatacctgagcacgttgtactatgag
tgtgaccccggatatgtgctgaatggcactgagaggagaacatgccaggatgacaaaaac
tgggatgaggatgagcccatttgcattcctgtggactgcagttcacccccagtctcagcc
aatggccaggtgagaggagacgagtacacattccaaaaagagattgaatacacttgcaat
gaagggttcttgcttgagggagccaggagtcgggtttgtcttgccaatggaagttggagt
ggagccactcccgactgtgtgcctgtcagatgtgccaccccgccacaactggccaatggg
gtgacggaaggcctggactatggcttcatgaaggaagtaacattccactgtcacgagggc
tacatcttgcacggtgctccaaaactcacctgtcagtcagatggcaactgggatgcagag
attcctctctgtaaaccagtcaactgtggacctcctgaagatcttgcccatggtttccct
aatggtttttcctttattcatgggggccatatacagtatcagtgctttcctggttataag
ctccatggaaattcatcaagaaggtgcctctccaatggctcctggagtggcagctcacct
tcctgcctgccttgcagatgttccacaccagtaattgaatatggaactgtcaatgggaca
gattttgactgtggaaaggcagcccggattcagtgcttcaaaggcttcaagctcctagga
ctttctgaaatcacctgtgaagccgatggccagtggagctctgggttcccccactgtgaa
cacacttcttgtggttctcttccaatgataccaaatgcgttcatcagtgagaccagctct
tggaaggaaaatgtgataacttacagctgcaggtctggatatgtcatacaaggcagttca
gatctgatttgtacagagaaaggggtatggagccagccttatccagtctgtgagcccttg
tcctgtgggtccccaccgtctgtcgccaatgcagtggcaactggagaggcacacacctat
gaaagtgaagtgaaactcagatgtctggaaggttatacgatggatacagatacagataca
ttcacctgtcagaaagatggtcgctggttccctgagagaatctcctgcagtcctaaaaaa
tgtcctctcccggaaaacataacacatatacttgtacatggggacgatttcagtgtgaat
aggcaagtttctgtgtcatgtgcagaagggtatacctttgagggagttaacatatcagta
tgtcagcttgatggaacctgggagccaccattctccgatgaatcttgcagtccagtttct
tgtgggaaacctgaaagtccagaacatggatttgtggttggcagtaaatacacctttgaa
agcacaattatttatcagtgtgagcctggctatgaactagaggggaacagggaacgtgtc
tgccaggagaacagacagtggagtggaggggtggcaatatgcaaagagaccaggtgtgaa
actccacttgaatttctcaatgggaaagctgacattgaaaacaggacgactggacccaac
gtggtatattcctgcaacagaggctacagtcttgaagggccatctgaggcacactgcaca
gaaaatggaacctggagccacccagtccctctctgcaaaccaaatccatgccctgttcct
tttgtgattcccgagaatgctctgctgtctgaaaaggagttttatgttgatcagaatgtg
tccatcaaatgtagggaaggttttctgctgcagggccacggcatcattacctgcaacccc
gacgagacgtggacacagacaagcgccaaatgtgaaaaaatctcatgtggtccaccagct
cacgtagaaaatgcaattgctcgaggcgtacattatcaatatggagacatgatcacctac
tcatgttacagtggatacatgttggagggtttcctgaggagtgtttgtttagaaaatgga
acatggacatcacctcctatttgcagagctgtctgtcgatttccatgtcagaatgggggc
atctgccaacgcccaaatgcttgttcctgtccagagggctggatggggcgcctctgtgaa
gaaccaatctgcattcttccctgtctgaacggaggtcgctgtgtggccccttaccagtgt
gactgcccgcctggctggacggggtctcgctgtcatacagctgtttgccagtctccctgc
ttaaatggtggaaaatgtgtaagaccaaaccgatgtcactgtctttcttcttggacggga
cataactgttccaggaaaaggaggactgggttttaa

DBGET integrated database retrieval system