KEGG   Homo sapiens (human): 79998Help
Entry
79998             CDS       T01001                                 

Gene name
ANKRD53
Definition
(RefSeq) ankyrin repeat domain 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    79998 (ANKRD53)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    79998 (ANKRD53)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank Ank_5 Ank_4 Ank_3
Motif
Other DBs
NCBI-GeneID: 79998
NCBI-ProteinID: NP_001108588
OMIM: 617009
HGNC: 25691
Ensembl: ENSG00000144031
Vega: OTTHUMG00000129712
Pharos: Q8N9V6(Tdark)
UniProt: Q8N9V6
Position
2p13.3
AA seq 530 aa AA seqDB search
MASAGSTARRAGSGSWHSERGEGRGARPQPTPSGSMQQANKVSLKATWTDAESKQPSQPL
PDLADHLSAQATALARPRRPASLTPPRADPSPSKESDQTAIDQTAIGSYYQLFAAAVGNV
EWLRFCLNQSLREIPTDDKGFTAIHFAAQWGKLACLQVLVEEYKFPVDLLTNNSQTPLHL
VIHRDNTTVALPCIYYLLEKGADLNAQTCNGSTPLHLAARDGLLDCVKVLVQSGANVHAQ
DAMGYKPIDFCKIWNHRACARFLKDAMWKKDKKDFAREMTKMKMFKSQLTLMEHNYLIEY
QKEHKILREAAIRKWLHGKLHPGHSLVSNTKQARATALSKTPEQRESQRSRSFHPSVDAR
LQCIPQPTEMPKPIYRKPTVKRPTMWNVSNNPARPPTTQISHSQGIRLGVHPDPTPEHDF
SSFLEVRPDGHGGARLHTVDGHWVAPVPRLPFEVLLRMLYPRVWPYRMKVPQGFYPISMR
EVPRKRHLGDNTFWTDTLAMNLRDTFDEAFLAAVRSHQGLPTLPSPQTNP
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggcctccgcgggcagcaccgctcggcgggcgggctccggaagctggcactcagaaagg
ggagaagggagaggtgctcggccgcagccaactccaagtggctccatgcagcaggcgaac
aaagtctccttgaaggccacctggactgacgcggagtccaagcagcccagccagcccctg
cccgacctcgcagaccacctcagtgcgcaggcgactgccctcgccaggccgcgccgccct
gcctcgctcaccccgccccgcgctgaccccagccccagcaaggagtccgaccagacggca
atcgaccagacggcgatcgggagctactaccagctgttcgcagcggctgtgggcaacgtg
gaatggctgcgattctgtctgaaccagagcctcagggaaatccccaccgacgacaagggc
ttcactgccatccacttcgccgcccaatggggcaagcttgcatgcctgcaggtcctggta
gaggagtacaagtttcccgtggacctgctgaccaacaatagccagacacccctgcacctc
gtcatccacagggacaacaccaccgtggccctcccctgcatctactacctgctggagaaa
ggcgcagacctcaatgctcagacatgcaacggctccacgcccctgcacctggcagcccgt
gacggcttgctggactgtgtgaaggtcctggtgcagagtggcgccaacgtccatgcccaa
gatgccatgggctacaaacccattgacttctgcaaaatatggaaccaccgtgcctgtgcc
cggttcttgaaggatgccatgtggaaaaaggacaagaaggactttgcccgtgagatgacg
aaaatgaagatgttcaagagccagctgaccctcatggagcacaactacctgattgagtat
caaaaagagcacaaaattctcagagaagctgctatcagaaagtggctccacggcaagctg
cacccaggccactctctggtctccaataccaagcaagcccgggccaccgccctctccaag
accccagagcaacgggaatcgcagcgttccaggagcttccacccctctgtggatgcacgc
ctgcaatgcattccacagcccacggagatgcccaagcccatctacaggaagcccacggtc
aagcggcccacaatgtggaatgttagcaacaaccccgccagaccccccaccacccagatc
agccactcgcagggcatccgcctgggcgtgcatccagaccccactccggagcacgacttc
agcagcttcctggaggtgaggcctgatgggcacggcggtgcgcggctgcacacagtggac
ggccactgggtggcgcccgtgccgcggctgccttttgaggtgctgctgcgcatgctgtac
ccacgtgtatggccatacagaatgaaggtgccccagggcttttaccccatcagcatgagg
gaagtgcccaggaagcggcacctgggtgacaacaccttctggaccgacactctggccatg
aacctgcgtgacacattcgatgaagccttcctggcagctgtgcgatctcatcaaggactc
cccaccctgccctccccacaaaccaacccataa

DBGET integrated database retrieval system