KEGG   Homo sapiens (human): 80122Help
Entry
80122             CDS       T01001                                 

Gene name
MAP3K19, RCK, YSK4
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 19
  KO
K17533  mitogen-activated protein kinase kinase kinase 19 [EC:2.7.11.25]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    80122 (MAP3K19)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     80122 (MAP3K19)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE11 family
   80122 (MAP3K19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 80122
NCBI-ProteinID: NP_079328
HGNC: 26249
Ensembl: ENSG00000176601
Vega: OTTHUMG00000074083
Pharos: Q56UN5(Tchem)
UniProt: Q56UN5
Position
2q21.3
AA seq 1328 aa AA seqDB search
MSSMPKPERHAESLLDICHDTNSSPTDLMTVTKNQNIILQSISRSEEFDQDGDCSHSTLV
NEEEDPSGGRQDWQPRTEGVEITVTFPRDVSPPQEMSQEDLKEKNLINSSLQEWAQAHAV
SHPNEIETVELRKKKLTMRPLVLQKEESSRELCNVNLGFLLPRSCLELNISKSVTREDAP
HFLKEQQRKSEEFSTSHMKYSGRSIKFLLPPLSLLPTRSGVLTIPQNHKFPKEKERNIPS
LTSFVPKLSVSVRQSDELSPSNEPPGALVKSLMDPTLRSSDGFIWSRNMCSFPKTNHHRQ
CLEKEENWKSKEIEECNKIEITHFEKGQSLVSFENLKEGNIPAVREEDIDCHGSKTRKPE
EENSQYLSSRKNESSVAKNYEQDPEIVCTIPSKFQETQHSEITPSQDEEMRNNKAASKRV
SLHKNEAMEPNNILEECTVLKSLSSVVFDDPIDKLPEGCSSMETNIKISIAERAKPEMSR
MVPLIHITFPVDGSPKEPVIAKPSLQTRKGTIHNNHSVNIPVHQENDKHKMNSHRSKLDS
KTKTSKKTPQNFVISTEGPIKPTMHKTSIKTQIFPALGLVDPRPWQLPRFQKKMPQIAKK
QSTHRTQKPKKQSFPCICKNPGTQKSCVPLSVQPTEPRLNYLDLKYSDMFKEINSTANGP
GIYEMFGTPVYCHVRETERDENTYYREICSAPSGRRITNKCRSSHSERKSNIRTRLSQKK
THMKCPKTSFGIKQEHKVLISKEKSSKAVHSNLHDIENGDGISEPDWQIKSSGNEFLSSK
DEIHPMNLAQTPEQSMKQNEFPPVSDLSIVEEVSMEESTGDRDISNNQILTTSLRDLQEL
EELHHQIPFIPSEDSWAVPSEKNSNKYVQQEKQNTASLSKVNASRILTNDLEFDSVSDHS
KTLTNFSFQAKQESASSQTYQYWVHYLDHDSLANKSITYQMFGKTLSGTNSISQEIMDSV
NNEELTDELLGCLAAELLALDEKDNNSCQKMANETDPENLNLVLRWRGSTPKEMGRETTK
VKIQRHSSGLRIYDREEKFLISNEKKIFSENSLKSEEPILWTKGEILGKGAYGTVYCGLT
SQGQLIAVKQVALDTSNKLAAEKEYRKLQEEVDLLKALKHVNIVAYLGTCLQENTVSIFM
EFVPGGSISSIINRFGPLPEMVFCKYTKQILQGVAYLHENCVVHRDIKGNNVMLMPTGII
KLIDFGCARRLAWAGLNGTHSDMLKSMHGTPYWMAPEVINESGYGRKSDIWSIGCTVFEM
ATGKPPLASMDRMAAMFYIGAHRGLMPPLPDHFSENAADFVRMCLTRDQHERPSALQLLK
HSFLERSH
NT seq 3987 nt NT seq  +upstreamnt  +downstreamnt
atgagttctatgccaaaaccagaaagacatgctgagtcattgcttgacatttgtcatgat
acaaactcttctccaactgatttgatgacagttaccaaaaatcaaaacatcatcttgcaa
agcatcagcagaagtgaggagttcgaccaagatggtgactgcagtcattccacactggtt
aatgaagaagaagatcccagtggtggtagacaggactggcaacccaggacagaaggtgtt
gagatcactgtaacttttccaagagatgtcagtcctccccaagaaatgagccaagaagac
ttaaaagaaaagaatctgataaactcatcgcttcaagaatgggcacaagcacatgcagtt
tctcatccaaatgaaatagaaacggtggagctcaggaaaaagaagctgaccatgcggccc
ttagttttgcaaaaagaggaaagttccagggagctctgcaatgtgaacttgggctttttg
ctaccaagatcttgtttagaactgaacatttccaagtctgtaaccagagaagatgctcct
cattttctgaaggagcagcaaagaaaatctgaagagttttcgacctctcatatgaagtac
agtggccgaagcatcaagttccttctgccaccactgtcactcttgcccacgcgatctggt
gtccttactatcccccaaaatcacaagtttccaaaagaaaaagaaagaaacattccaagt
ctcacatcttttgtgcctaagctctcagtgtctgttcgtcaatctgatgagctcagccca
tcaaacgagcctccgggagccctagttaagtcgttgatggatccgactctcaggtcttct
gatggcttcatttggtcaagaaacatgtgctcttttcctaagactaaccatcacaggcaa
tgcctggagaaggaggaaaactggaaatccaaggaaatagaagaatgtaacaaaattgaa
atcactcactttgaaaaagggcagtctttggtgtcttttgagaatttgaaggaaggcaat
attcctgcagttagggaagaggatattgactgccatggtagtaaaacgcgaaaacctgaa
gaagagaactctcaatatctttcatcaagaaagaatgagagttcagtagccaaaaactat
gaacaagatccagaaatagtatgtaccattccaagcaagttccaagaaacccagcattca
gaaataactccaagccaggatgaagagatgagaaataataaagctgcttcaaaaagagtt
tcattacataaaaatgaagcaatggaaccaaacaatattttagaagagtgtactgtactt
aaaagcttatccagtgtagtctttgatgaccccattgataaactcccagaaggttgtagc
agcatggagacaaacataaaaatatcaatagcagaaagagccaaaccagaaatgagtagg
atggtgcctcttatccacatcaccttccctgtggatggaagccccaaggaaccagtgata
gccaaaccaagcctccaaacaagaaagggaaccattcataacaaccatagtgtcaacata
cctgtacaccaagaaaatgacaagcataagatgaattcccataggagtaagttggattca
aagaccaagacaagtaagaagacacctcagaattttgtgatttctactgaaggtcccatt
aagcctaccatgcataaaaccagcataaaaacacaaattttcccggctttgggacttgtg
gaccccaggccttggcaattgcccaggtttcaaaagaaaatgccacagatagcaaagaag
caatcaactcaccggactcagaaacctaaaaagcaatcatttccttgcatctgtaaaaat
ccaggaacacagaagtcatgtgttcctctctctgttcaaccgacagagccaagactaaat
tacctagatcttaagtatagtgatatgttcaaagaaatcaattcaactgctaatggacct
ggaatctatgaaatgtttgggacccctgtttattgtcatgtgcgagagactgaaagggat
gaaaacacgtattaccgtgagatatgttcggctccatcaggcagacgtatcaccaataaa
tgtcgatcttcacacagtgagaggaagagcaatatcagaacaagactttctcagaaaaaa
acacatatgaaatgcccaaagacttcatttggcattaaacaagagcacaaagtcttaatt
tctaaagaaaagagttccaaggctgtacatagcaacctacatgacattgaaaatggtgat
ggtatttcagaaccagactggcagataaagtcttcaggaaatgagtttctatcttccaaa
gatgaaattcatcccatgaacttggctcagacacctgagcagtccatgaaacagaatgaa
ttccctcctgtctcagatttatccattgttgaagaagtttctatggaagagtctactggt
gatagagacatttctaacaatcaaatactcaccacaagcctcagagatctgcaagaactt
gaagagctacatcaccagatcccatttatcccttcagaagacagctgggcagtgcccagt
gagaagaattctaacaagtatgtacagcaagaaaagcagaatacagcatctcttagtaaa
gtaaatgccagccgaattttaactaatgatctagagtttgatagtgtttcagatcactct
aaaacacttacaaatttctctttccaagcaaaacaagaaagtgcatcttcccagacatat
caatattgggtacattatttggatcatgatagtttagcaaataagtcaatcacatatcaa
atgtttggaaaaaccttaagtggcacaaattcaatttcccaagaaattatggactctgta
aataatgaagaattgacagatgaactattaggttgtctagctgcagaattattagctctt
gatgagaaagataacaactcttgccaaaaaatggcaaatgaaacagatcctgaaaaccta
aatcttgtcctcagatggagaggaagtaccccaaaagaaatgggcagagagacaacaaaa
gtcaaaatacagaggcatagtagtgggctcaggatatatgacagggaggagaaatttctc
atctcaaatgaaaagaagatattttctgaaaatagtttaaagtctgaagaacctatccta
tggaccaagggtgagattcttggaaagggagcctacggcacagtatactgtggtctcact
agtcaaggacagctaatagctgtaaaacaggtggctttggatacctctaataaattagct
gctgaaaaggaataccggaaactacaggaagaagtagatttgctcaaagcactgaaacat
gtcaacattgtggcctatttggggacatgcttgcaagagaacactgtgagcattttcatg
gagtttgttcctggtggctcaatctctagtattataaaccgttttgggccattgcctgag
atggtgttctgtaaatatacgaaacaaatacttcaaggtgttgcttatctccatgagaac
tgtgtggtacatcgcgatatcaaaggaaataatgttatgctcatgccaactggaataata
aagctgattgactttggctgtgccaggcgtttggcctgggcaggtttaaatggcacccac
agtgacatgcttaagtccatgcatgggactccatattggatggccccagaagtcatcaat
gagtctggctatggacggaaatcagatatctggagcattggttgtactgtgtttgagatg
gctacagggaagcctccactggcttccatggacaggatggccgccatgttttacatcgga
gcacaccgagggctgatgcctcctttaccagaccacttctcagaaaatgcagcagacttt
gtgcgcatgtgcctgaccagggaccagcatgagcgaccttctgctctccagctcctgaag
cactccttcttggagagaagtcactga

DBGET integrated database retrieval system