KEGG   Homo sapiens (human): 80232
Entry
80232             CDS       T01001                                 
Symbol
WDR26, CDW2, GID7, MIP2, SKDEAS
Name
(RefSeq) WD repeat domain 26
  KO
K22382  WD repeat-containing protein 26
Organism
hsa  Homo sapiens (human)
Disease
H02337  Skraban-Deardorff syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    80232 (WDR26)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     80232 (WDR26)
   CTLH complex
    80232 (WDR26)
SSDB
Motif
Pfam: WD40 NBCH_WD40 LisH_TPL ANAPC4_WD40 eIF2A Ge1_WD40
Other DBs
NCBI-GeneID: 80232
NCBI-ProteinID: NP_079436
OMIM: 617424
HGNC: 21208
Ensembl: ENSG00000162923
Pharos: Q9H7D7(Tbio)
UniProt: Q9H7D7
Position
1:complement(224385146..224434797)
AA seq 661 aa
MQANGAGGGGGGGGGGGGGGGGGGGQGQTPELACLSAQNGESSPSSSSSAGDLAHANGLL
PSAPSAASNNSNSLNVNNGVPGGAAAASSATVAAASATTAASSSLATPELGSSLKKKKRL
SQSDEDVIRLIGQHLNGLGLNQTVDLLMQESGCRLEHPSATKFRNHVMEGDWDKAENDLN
ELKPLVHSPHAIVVRGALEISQTLLGIIVRMKFLLLQQKYLEYLEDGKVLEALQVLRCEL
TPLKYNTERIHVLSGYLMCSHAEDLRAKAEWEGKGTASRSKLLDKLQTYLPPSVMLPPRR
LQTLLRQAVELQRDRCLYHNTKLDNNLDSVSLLIDHVCSRRQFPCYTQQILTEHCNEVWF
CKFSNDGTKLATGSKDTTVIIWQVDPDTHLLKLLKTLEGHAYGVSYIAWSPDDNYLVACG
PDDCSELWLWNVQTGELRTKMSQSHEDSLTSVAWNPDGKRFVTGGQRGQFYQCDLDGNLL
DSWEGVRVQCLWCLSDGKTVLASDTHQRIRGYNFEDLTDRNIVQEDHPIMSFTISKNGRL
ALLNVATQGVHLWDLQDRVLVRKYQGVTQGFYTIHSCFGGHNEDFIASGSEDHKVYIWHK
RSELPIAELTGHTRTVNCVSWNPQIPSMMASASDDGTVRIWGPAPFIDHQNIEEECSSMD
S
NT seq 1986 nt   +upstreamnt  +downstreamnt
atgcaggccaatggggcaggaggaggaggaggaggtggcggcggcggcggtggaggagga
gggggcggcgggggccagggacagaccccggaactcgcctgcttgtcggcccagaacggg
gagtcgtccccctcgtcgtcgtcgtccgcgggggacctggcccacgccaatgggctcctg
ccttccgccccctccgccgccagcaacaatagcaacagcctgaatgtcaataacggggtt
cccggcggggcggccgccgcatcctcagccaccgtcgcagctgcctccgccaccaccgcc
gcctcctcttccttggccaccccagaactgggcagcagcctcaagaagaagaagcggctc
tcccagtcagatgaggatgtcattaggctaataggacagcacttgaatggcttagggctc
aaccagactgttgatctcctcatgcaagagtcaggatgtcgtttagaacatccttctgct
accaaattccgaaatcatgtcatggaaggagactgggataaggcagaaaatgacctgaat
gaactaaagcctttagtgcattctcctcatgctattgtggtaagaggcgcacttgaaatc
tctcaaacgttgttgggaataattgtgaggatgaagtttttgctgctgcagcagaagtac
ctagaatacctggaggatggcaaggtcctggaggcacttcaagttctacgctgtgaattg
acgccgctgaaatacaatacagagcgcattcatgttcttagtgggtatctgatgtgtagc
catgcagaagacctacgtgcaaaagcagaatgggaaggcaaagggacagcttcccgatct
aaactattggataaacttcagacctatttaccaccatcagtgatgcttcccccacggcgt
ttacagactctcctgcggcaggcggtggaactacaaagggatcggtgcctatatcacaat
accaaacttgataataatctagattctgtgtctctgcttatagaccatgtttgtagtagg
aggcagttcccatgttatacgcagcagatacttacggagcattgtaatgaagtgtggttc
tgtaaattctctaatgatggcactaaactagcaacaggatcaaaagatacaacagttatc
atatggcaagttgatccggatacacacctgctaaaactgcttaaaacattagaaggacat
gcttatggcgtttcttatattgcatggagtccagatgacaactatcttgttgcttgtggc
ccagatgactgctctgagctttggctttggaatgtacaaacaggagaactaaggacaaaa
atgagccagtctcatgaagacagtttgacaagtgtggcttggaatccagatgggaagcgc
tttgtgactggaggtcagcgtgggcagttctatcagtgtgacttagatggtaatctcctt
gactcctgggaaggggtaagagtgcaatgcctttggtgcttgagtgatggaaagactgtt
ctggcatcagatacacaccagcgaattcggggctataacttcgaggaccttacagatagg
aacatagtacaagaagatcatcctattatgtcttttactatttcaaaaaatggccgatta
gctttgttaaatgtagcaactcagggagttcatttatgggacttgcaagacagagtttta
gtaagaaagtatcaaggtgttacacaagggttttatacaattcattcatgttttggaggc
cataatgaagacttcatcgctagtggcagtgaagatcacaaggtttacatctggcacaaa
cgtagtgaactgccaattgcggagctgacagggcacacacgtacagtaaactgtgtgagc
tggaacccacagattccatccatgatggccagcgcctcagatgatggcactgttagaata
tggggaccagcaccttttatagaccaccagaatattgaagaggaatgcagtagcatggat
agttga

DBGET integrated database retrieval system