KEGG   Homo sapiens (human): 80725Help
Entry
80725             CDS       T01001                                 

Gene name
SRCIN1, P140, SNIP
Definition
(RefSeq) SRC kinase signaling inhibitor 1
  KO
K19930  SRC kinase signaling inhibitor 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    80725 (SRCIN1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    80725 (SRCIN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AIP3
Motif
Other DBs
NCBI-GeneID: 80725
NCBI-ProteinID: NP_079524
OMIM: 610786
HGNC: 29506
Ensembl: ENSG00000277363
Vega: OTTHUMG00000188493
Pharos: Q9C0H9(Tbio)
UniProt: Q9C0H9
Position
17q12
AA seq 1183 aa AA seqDB search
MGNAPSQDPERSSPPMLSADDAEYPREYRTLGGGGGGGSGGRRFSNVGLVHTSERRHTVI
AAQSLEALSGLQKADADRKRDAFMDHLKSKYPQHALALRGQQDRMREQPNYWSFKTRSSR
HTQGAQPGLADQAAKLSYASAESLETMSEAELPLGFSRMNRFRQSLPLSRSASQTKLRSP
GVLFLQFGEETRRVHITHEVSSLDTLHALIAHMFPQKLTMGMLKSPNTAILIKDEARNVF
YELEDVRDIQDRSIIKIYRKEPLYAAFPGSHLTNGDLRREMVYASRESSPTRRLNNLSPA
PHLASGSPPPGLPSGLPSGLQSGSPSRSRLSYAGGRPPSYAGSPVHHAAERLGGAPAAQG
VSPSPSAILERRDVKPDEDLASKAGGMVLVKGEGLYADPYGLLHEGRLSLAAAAGDPFAY
PGAGGLYKRGSVRSLSTYSAAALQSDLEDSLYKAAGGGGPLYGDGYGFRLPPSSPQKLAD
VAAPPGGPPPPHSPYSGPPSRGSPVRQSFRKDSGSSSVFAESPGGKTRSAGSASTAGAPP
SELFPGPGERSLVGFGPPVPAKDTETRERMEAMEKQIASLTGLVQSALLRGSEPETPSEK
IEGSNGAATPSAPCGSGGRSSGATPVSGPPPPSASSTPAGQPTAVSRLQMQLHLRGLQNS
ASDLRGQLQQLRKLQLQNQESVRALLKRTEAELSMRVSEAARRQEDPLQRQRTLVEEERL
RYLNDEELITQQLNDLEKSVEKIQRDVSHNHRLVPGPELEEKALVLKQLGETLTELKAHF
PGLQSKMRVVLRVEVEAVKFLKEEPQRLDGLLKRCRGVTDTLAQIRRQVDEGVWPPPNNL
LSQSPKKVTAETDFNKSVDFEMPPPSPPLNLHELSGPAEGASLTPKGGNPTKGLDTPGKR
SVDKAVSVEAAERDWEEKRAALTQYSAKDINRLLEETQAELLKAIPDLDCASKAHPGPAP
TPDHKPPKAPHGQKAAPRTEPSGRRGSDELTVPRYRTEKPSKSPPPPPPRRSFPSSHGLT
TTRTGEVVVTSKKDSAFIKKAESEELEVQKPQVKLRRAVSEVARPASTPPIMASAIKDED
DEDRIIAELESGGGSVPPMKVVTPGASRLKAAQGQAGSPDKSKHGKQRAEYMRIQAQQQA
TKPSKEMSGSNETSSPVSEKPSASRTSIPVLTSFGARNSSISF
NT seq 3552 nt NT seq  +upstreamnt  +downstreamnt
atggggaacgctccgtcccaagatccggagcggagcagcccccccatgctgtctgcggac
gatgcggagtacccgcgggagtaccggaccctggggggcgggggcggcgggggcagcggg
ggccggcgcttctccaacgtggggctggtgcacacgtccgagcggcggcacacggtgatc
gcggcccagagtctggaggcgctcagcgggctccagaaggcggacgccgaccgcaagcgt
gatgccttcatggaccacctgaagagcaagtacccacagcacgccctggccctgcgaggc
cagcaggacaggatgcgagagcagccaaactactggagtttcaagacccgcagctcacgc
cacactcagggagcccagcccgggctggcagaccaggcggcaaagctgtcctacgcctcc
gccgagtcgctggagaccatgtcggaggccgagctgcccctgggcttcagcaggatgaac
cgcttccgacagagcctgcctctctcccgctcggccagccagaccaagctgcgctcccca
ggggtgctgttcctgcagttcggggaggagactcggcgcgtgcacatcacgcacgaggtc
agcagcctggacacgctgcacgcactcatcgcgcacatgttcccgcagaagctcaccatg
ggcatgcttaagtcgcccaataccgccatcctcatcaaagacgaggctcgcaacgtcttc
tacgagctggaggacgtccgggacatccaggaccgcagtattatcaagatctacagaaag
gagcccctctacgctgccttccctggctcacatctcaccaacggggacctccggagagag
atggtgtacgcatcgcgggagtcctcgcccacgcggcgcctcaacaacctgtcaccagcg
ccgcacctggcatccggctcgccgccgcccgggctgccgtcggggctgccgtccgggctg
cagtccggttcgccgtcgcgttcgcgcctatcgtacgccggggggcgcccgccttcgtac
gccggcagcccggtgcaccacgcggccgagaggctgggaggcgccccggccgcccagggc
gtcagccccagccccagcgccatcctggagcggcgcgacgtgaagccggacgaggacctg
gcgagcaaggcgggcggcatggtgctggtgaaaggcgagggcctctatgctgacccctac
gggctgctgcacgagggccgtctgagcctggccgcggccgccggcgacccgttcgcctac
ccgggcgccggcggcctctacaagcgcggctcggtgcgctcgctcagcacctactcggcc
gccgcgctgcagtccgatctggaggactccctgtacaaggcggcgggcggcggcggcccg
ctgtacggcgacggctacggcttccgcctgccgccttcgtcaccgcagaagctggccgac
gtggcagcaccccccggaggtcccccgccaccgcacagcccctactcggggccgcccagc
cgcggctcgccagtgcgccagtccttccgcaaggactcgggctcctcgtccgtctttgcc
gagagtcctggagggaagacccgcagcgcggggagcgcctcgacggccggagctccccct
tcggagctcttccctgggcctggggaacgctcgctggttgggttcgggccgccagtgcca
gccaaggacacggagaccagggagcgcatggaggccatggagaagcagattgccagcctc
acaggcctggtgcagagcgccttactgcgaggctctgagcctgagacccccagcgagaag
attgaaggctccaatggagcagccaccccctcagcaccctgtgggtcaggcggccggagc
agcggggccaccccggtgtccggcccgcccccgccctcggccagcagcacccccgcaggt
cagcctaccgccgttagccggctgcagatgcagcttcacctgcgaggcctgcagaacagc
gccagtgacttgcgcggccagctccagcagttgcgcaagctccagctacagaaccaggag
tcggtgcgcgcgctgctgaagcgcacggaggcagagctgagcatgcgcgtgtcggaggcg
gcgcggcggcaggaggacccgctgcagcggcagcgcaccctggtggaagaggaacggctg
cgctatctcaacgacgaggagcttattacccagcagctcaatgacctggagaaatcggtg
gagaagatccagagagacgtgtcccacaaccaccggctggtgcccggccctgagctggag
gagaaggcactggtgctgaagcagctcggggagacgctgacagagctcaaggctcacttc
ccgggcctgcagagcaagatgcgggtggtgctgcgcgtggaggtggaggcggtgaagttc
ctgaaggaggagccccagcgcctggatgggctcctcaagcgctgccgcggggtcacggac
acgctggcccagatccgaaggcaagtggatgagggtgtgtggccaccccccaacaatctc
ctgagtcagtcccccaagaaggtgacggcagagactgacttcaacaagagcgtggacttc
gaaatgccaccccccagccccccgctgaacctgcatgagctgagcgggccagctgaagga
gcctctcttacccccaaggggggcaaccccaccaaaggcctggacactcctggcaagaga
agcgtggacaaagctgtgtctgttgaggctgcagagcgagactgggaggagaagcgggca
gccctgacccagtacagtgccaaggacatcaaccggctgctggaagagacacaggcagag
ctgctcaaggccatccctgacctggactgtgccagcaaggcccatccaggcccggccccc
actccagatcacaagccccccaaggccccccacggccagaaggcagccccccgaacggag
cccagtgggaggaggggctcagatgagttgaccgtgccccgataccgcacagagaagccc
tccaagtcgcccccaccgccccctccccgccggagcttcccctcctcccatggcctgacc
accacacgtaccggagaggtggtggtcaccagcaagaaggactcggccttcatcaagaag
gctgagtccgaggagctggaggtgcagaagccccaggtgaagctgcgccgggctgtgtct
gaggtggcccgcccagcctccacaccacccatcatggcctcggccatcaaggacgaggat
gacgaggatcgcatcatcgcagagctagagagtggcggaggcagtgtaccacccatgaag
gtggtgactccgggggcctctcggctgaaggcggcccagggccaggcgggcagccccgac
aaaagcaaacatggcaagcagagggccgagtacatgcggatccaggcccagcagcaggcc
actaaaccatctaaagagatgagcgggtcgaatgagacctcgagcccagtctcagaaaag
ccctcggcttccagaacctctatccctgtattgacttcctttggggcaaggaattcttcc
atctccttctag

DBGET integrated database retrieval system