KEGG   Homo sapiens (human): 81553Help
Entry
81553             CDS       T01001                                 

Gene name
FAM49A
Definition
(RefSeq) family with sequence similarity 49 member A
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF1394
Motif
Other DBs
NCBI-GeneID: 81553
NCBI-ProteinID: NP_110424
HGNC: 25373
Ensembl: ENSG00000197872
Vega: OTTHUMG00000090615
Pharos: Q9H0Q0(Tdark)
UniProt: Q9H0Q0
Position
2p24.2
AA seq 323 aa AA seqDB search
MGNLLKVLTREIENYPHFFLDFENAQPTEGEREIWNQISAVLQDSESILADLQAYKGAGP
EIRDAIQNPNDIQLQEKAWNAVCPLVVRLKRFYEFSIRLEKALQSLLESLTCPPYTPTQH
LEREQALAKEFAEILHFTLRFDELKMRNPAIQNDFSYYRRTISRNRINNMHLDIENEVNN
EMANRMSLFYAEATPMLKTLSNATMHFVSENKTLPIENTTDCLSTMTSVCKVMLETPEYR
SRFTSEETLMFCMRVMVGVIILYDHVHPVGAFCKTSKIDMKGCIKVLKEQAPDSVEGLLN
ALRFTTKHLNDESTSKQIRAMLQ
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacctgctcaaagtccttaccagggaaattgaaaactatccacactttttcctg
gattttgaaaatgctcagcctacagaaggagagagagaaatctggaaccagatcagcgcc
gtccttcaggattctgagagcatccttgcagacctgcaggcttacaaaggcgcaggccca
gagatccgagatgcaattcaaaatcccaatgacattcagcttcaagaaaaagcttggaat
gcggtgtgccctcttgttgtgaggctaaagagattttacgagttttccattagactagaa
aaagctcttcagagtttattggaatctctgacttgtccaccctacacaccaacccaacac
ctggaaagggaacaggccctggcaaaggagtttgccgaaattttacattttacccttcga
ttcgatgagctgaagatgaggaacccggctattcagaatgacttcagctactacagaaga
acaatcagtcgcaaccgcatcaacaacatgcacctagacattgagaatgaagtcaataat
gagatggccaatcgaatgtccctcttctatgcagaagccacgccaatgctgaaaaccctt
agcaatgccacaatgcactttgtctctgaaaacaaaactctgccaatagagaacaccaca
gactgcctcagcacaatgacaagtgtctgtaaagtcatgctggaaactccggagtacaga
agtaggtttacgagtgaagagaccctgatgttctgcatgagggtgatggtgggagtcatc
atcctctatgaccatgtccaccctgtgggagctttctgcaagacatccaagatcgatatg
aaaggctgcataaaagttttgaaggagcaggccccagacagtgtggaggggctgctaaat
gccctcaggttcactacaaagcacttgaacgatgaatcaacttccaaacagattcgagca
atgcttcagtag

DBGET integrated database retrieval system