KEGG   Homo sapiens (human): 81607Help
Entry
81607             CDS       T01001                                 

Gene name
NECTIN4, EDSS1, LNIR, PRR4, PVRL4, nectin-4
Definition
(RefSeq) nectin cell adhesion molecule 4
  KO
K06593  poliovirus receptor-related 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04520  Adherens junction
Disease
H00647  Ectodermal dysplasia-syndactyly syndrome
Drug target
Enfortumab: D11524
Enfortumab vedotin: D11525
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    81607 (NECTIN4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    81607 (NECTIN4)
Cell adhesion molecules [BR:hsa04515]
 Immunoglobulin superfamily
  Nectin family
   81607 (NECTIN4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 V-set ig C2-set_2 I-set Ig_2 Ig_6 Protocadherin EphA2_TM Chordopox_A13L TMEM154 DUF4692 ABC_membrane_3 DUF2755 Herpes_glycop DUF3377 MAP17 Ctr LapA_dom DUF3169 Baculo_11_kDa
Motif
Other DBs
NCBI-GeneID: 81607
NCBI-ProteinID: NP_112178
OMIM: 609607
HGNC: 19688
Ensembl: ENSG00000143217
Vega: OTTHUMG00000031475
Pharos: Q96NY8(Tbio)
UniProt: Q96NY8 K4PZ75
Structure
PDB: 

Position
1q23.3
AA seq 510 aa AA seqDB search
MPLSLGAEMWGPEAWLLLLLLLASFTGRCPAGELETSDVVTVVLGQDAKLPCFYRGDSGE
QVGQVAWARVDAGEGAQELALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQA
DEGEYECRVSTFPAGSFQARLRLRVLVPPLPSLNPGPALEEGQGLTLAASCTAEGSPAPS
VTWDTEVKGTTSSRSFKHSRSAAVTSEFHLVPSRSMNGQPLTCVVSHPGLLQDQRITHIL
HVSFLAEASVRGLEDQNLWHIGREGAMLKCLSEGQPPPSYNWTRLDGPLPSGVRVDGDTL
GFPPLTTEHSGIYVCHVSNEFSSRDSQVTVDVLDPQEDSGKQVDLVSASVVVVGVIAALL
FCLLVVVVVLMSRYHRRKAQQMTQKYEEELTLTRENSIRRLHSHHTDPRSQPEESVGLRA
EGHPDSLKDNSSCSVMSEEPEGRSYSTLTTVREIETQTELLSPGSGRAEEEEDQDEGIKQ
AMNHFVQENGTLRAKPTGNGIYINGRGHLV
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgtccctgggagccgagatgtgggggcctgaggcctggctgctgctgctgcta
ctgctggcatcatttacaggccggtgccccgcgggtgagctggagacctcagacgtggta
actgtggtgctgggccaggacgcaaaactgccctgcttctaccgaggggactccggcgag
caagtggggcaagtggcatgggctcgggtggacgcgggcgaaggcgcccaggaactagcg
ctactgcactccaaatacgggcttcatgtgagcccggcttacgagggccgcgtggagcag
ccgccgcccccacgcaaccccctggacggctcagtgctcctgcgcaacgcagtgcaggcg
gatgagggcgagtacgagtgccgggtcagcaccttccccgccggcagcttccaggcgcgg
ctgcggctccgagtgctggtgcctcccctgccctcactgaatcctggtccagcactagaa
gagggccagggcctgaccctggcagcctcctgcacagctgagggcagcccagcccccagc
gtgacctgggacacggaggtcaaaggcacaacgtccagccgttccttcaagcactcccgc
tctgctgccgtcacctcagagttccacttggtgcctagccgcagcatgaatgggcagcca
ctgacttgtgtggtgtcccatcctggcctgctccaggaccaaaggatcacccacatcctc
cacgtgtccttccttgctgaggcctctgtgaggggccttgaagaccaaaatctgtggcac
attggcagagaaggagctatgctcaagtgcctgagtgaagggcagccccctccctcatac
aactggacacggctggatgggcctctgcccagtggggtacgagtggatggggacactttg
ggctttcccccactgaccactgagcacagcggcatctacgtctgccatgtcagcaatgag
ttctcctcaagggattctcaggtcactgtggatgttcttgacccccaggaagactctggg
aagcaggtggacctagtgtcagcctcggtggtggtggtgggtgtgatcgccgcactcttg
ttctgccttctggtggtggtggtggtgctcatgtcccgataccatcggcgcaaggcccag
cagatgacccagaaatatgaggaggagctgaccctgaccagggagaactccatccggagg
ctgcattcccatcacacggaccccaggagccagccggaggagagtgtagggctgagagcc
gagggccaccctgatagtctcaaggacaacagtagctgctctgtgatgagtgaagagccc
gagggccgcagttactccacgctgaccacggtgagggagatagaaacacagactgaactg
ctgtctccaggctctgggcgggccgaggaggaggaagatcaggatgaaggcatcaaacag
gccatgaaccattttgttcaggagaatgggaccctacgggccaagcccacgggcaatggc
atctacatcaatgggcggggacacctggtctga

DBGET integrated database retrieval system