KEGG   Homo sapiens (human): 81615Help
Entry
81615             CDS       T01001                                 

Gene name
TMEM163, DC29, SV31
Definition
(RefSeq) transmembrane protein 163
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Cation_efflux
Motif
Other DBs
NCBI-GeneID: 81615
NCBI-ProteinID: NP_112185
HGNC: 25380
Ensembl: ENSG00000152128
Vega: OTTHUMG00000131713
Pharos: Q8TC26(Tdark)
UniProt: Q8TC26
Position
2q21.3
AA seq 289 aa AA seqDB search
MEPAAGIQRRSSQGPTVPPPPRGHAPPAAAPGPAPLSSPVREPPQLEEERQVRISESGQF
SDGLEDRGLLESSTRLKPHEAQNYRKKALWVSWFSIIVTLALAVAAFTVSVMRYSASAFG
FAFDAILDVLSSAIVLWRYSNAAAVHSAHREYIACVILGVIFLLSSICIVVKAIHDLSTR
LLPEVDDFLFSVSILSGILCSILAVLKFMLGKVLTSRALITDGFNSLVGGVMGFSILLSA
EVFKHDSAVWYLDGSIGVLIGLTIFAYGVKLLIDMVPRVRQTRHYEMFE
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggagccggccgcgggcatccagcgccgcagctcccaggggcccaccgtcccgccgccg
ccccggggccacgcgccaccggctgccgcccccggcccggccccgctgagctccccggtg
cgcgagccgccccagctggaggaggagcggcaggtgcggatcagcgagagcggccagttc
agcgacgggctggaggaccgaggcttactagaaagcagcacccgcctgaaacctcacgaa
gcccagaactacaggaagaaggcattgtgggtgtcctggttctccatcattgtcaccctg
gccctcgcggtggctgcctttactgtctccgttatgaggtacagcgcctctgcttttggg
tttgcatttgatgccatcctggacgtcctgtcatcggcgattgtcctgtggcgttacagc
aacgcggccgctgtgcactctgcccatagggagtacatagcctgtgtcatcttgggggtg
atattccttctgtcatccatatgtatagtggtcaaagccatccatgacctctcaactagg
ctgctcccagaagtggacgatttcctgttcagtgtctccattttaagtgggattctttgc
agcatcctggccgtgttgaagttcatgctggggaaggttctgaccagtagagcactcata
acagatgggtttaactccctcgtgggtggcgtgatgggcttctccattcttctgagcgcg
gaagtgttcaagcatgactcggcggtctggtacctggacggcagcataggcgttctgatc
ggcctcaccatatttgcctatggggtcaaactcctcatcgacatggtgccgagggtgagg
cagacacgtcactacgagatgtttgagtga

DBGET integrated database retrieval system