KEGG   Homo sapiens (human): 8175Help
Entry
8175              CDS       T01001                                 

Gene name
SF3A2, PRP11, PRPF11, SAP62, SF3a66
Definition
(RefSeq) splicing factor 3a subunit 2
  KO
K12826  splicing factor 3A subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Module
hsa_M00352  Spliceosome, U2-snRNP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    8175 (SF3A2)
Spliceosome [BR:hsa03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    8175 (SF3A2)
 Complex B
    8175 (SF3A2)
 Complex C
   U2 SnRNP specific factors
    8175 (SF3A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SF3A2 zf-met CactinC_cactus PRP4
Motif
Other DBs
NCBI-GeneID: 8175
NCBI-ProteinID: NP_009096
OMIM: 600796
HGNC: 10766
Ensembl: ENSG00000104897
Vega: OTTHUMG00000180414
Pharos: Q15428(Tbio)
UniProt: Q15428 Q05DF2
Position
19p13.3
AA seq 464 aa AA seqDB search
MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL
TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAPAQPAPEKVKVEVKKFVKIGRPGYKVT
KQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIA
FKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKPPAPPSLPAGPPGVKRPPPPLMNG
LPPRPPLPESLPPPPPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAPVVHPPASG
VHPPAPGVHPPAPGVHPPAPGVHPPTSGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPP
APGVHPPPSAGVHPQAPGVHPAAPAVHPQAPGVHPPAPGMHPQAPGVHPQPPGVHPSAPG
VHPQPPGVHPSNPGVHPPTPMPPMLRPPLPSEGPGNIPPPPPTN
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggacttccagcatcgccccgggggcaagaccgggagcgggggcgtggcctcctcctcc
gagagcaaccgtgaccgcagggagcgcctccggcagctggccctggagaccatcgacatc
aacaaggacccgtacttcatgaagaaccacctgggctcctatgaatgcaaactctgcctg
acacttcacaacaatgaggggagctacctggcacatacgcaggggaagaagcaccagacc
aacctggcccggcgagcagccaaggaggccaaggaggcccctgcccagcccgcgcctgag
aaggtcaaggtggaggtgaagaagtttgtgaagatcggccgcccgggctacaaagtgacc
aagcagagagactcggagatgggccagcagagcctcctcttccagattgactaccctgag
atcgccgagggcatcatgccacgtcaccgcttcatgtctgcgtacgagcagaggatcgag
cctccggaccggcgctggcagtacctgctcatggccgccgagccctacgagaccattgcc
ttcaaggtgccgagcagagagatcgacaaggcggagggcaagttctggacacactggaac
cgggagaccaagcagttcttcctccagttccactttaagatggagaagcccccggctcca
cccagcctccctgctggcccccctggggtgaagcggcctccacccccgctgatgaacggt
ctgccccctcggccaccgctgcctgagtctttgccaccgcccccgccaggaggcctgcct
ctgccacccatgccccccacagggcctgcgccctcagggcccccgggaccaccccagcta
cccccgccagctccaggggtccaccccccggccccagtggtgcatccccctgcatctggg
gtccatcccccagctcctggcgtccaccccccagctcctggcgtccatcccccagcccct
ggggtccacccaccaacctctggggtccaccccccagctcctggagtccaccctccagcc
cccggggttcacccaccagcccccggagtccacccaccagcccctggggttcacccacca
gccccaggggtccatcctcccccatcagcgggggttcacccccaggccccgggggtgcac
ccagcagcccccgccgttcaccctcaggccccaggggtgcacccaccagccccagggatg
caccctcaggccccgggggtccacccccaacctcccggggtccatccgtcggctcctggg
gtccaccctcagcctccgggagttcacccctcaaatcctggggtgcaccccccaactccc
atgcccccaatgctgaggcccccacttccctccgaaggcccagggaacatacctccccct
cccccaaccaactga

DBGET integrated database retrieval system