KEGG   Homo sapiens (human): 83881
Entry
83881             CDS       T01001                                 
Symbol
MIXL1, MILD1, MIX, MIXL
Name
(RefSeq) Mix paired-like homeobox
  KO
K24900  homeobox protein MIXL1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    83881 (MIXL1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain Paired-related
    83881 (MIXL1)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 83881
NCBI-ProteinID: NP_114150
OMIM: 609852
HGNC: 13363
Ensembl: ENSG00000185155
Pharos: Q9H2W2(Tbio)
UniProt: Q9H2W2 A0A024R3T7
Position
1:226223664..226227060
AA seq 232 aa
MATAESRALQFAEGAAFPAYRAPHAGGALLPPPSPAAALLPAPPAGPGPATFAGFLGRDP
GPAPPPPASLGSPAPPKGAAAPSASQRRKRTSFSAEQLQLLELVFRRTRYPDIHLRERLA
ALTLLPESRIQVWFQNRRAKSRRQSGKSFQPLARPEIILNHCAPGTETKCLKPQLPLEVD
VNCLPEPNGVGGGISDSSSQGQNFETCSPLSEDIGSKLDSWEEHIFSAFGNF
NT seq 699 nt   +upstreamnt  +downstreamnt
atggccacagccgagtcccgtgcgctccagtttgccgagggcgccgcgtttccagcgtac
cgggccccccacgccggcggggcgctcctgccgcccccgagccctgcggcagccctgctc
cctgcgccgcccgcgggccccggcccagcgacctttgcgggcttcctcggccgggacccc
gggccggccccgccgccccccgccagcctgggctcgcctgcgccccccaaaggcgcggcc
gccccgtcggcgtcgcagcgccgcaagcgcacgtctttcagcgccgaacagctgcagctg
ctggagctcgtcttccgccggacccggtaccccgacatccacttgcgcgagcgcctggcc
gcgctcaccctgctccccgagtccaggatccaggtatggttccagaacaggcgtgccaag
tctcggcgtcagagtgggaaatccttccaacctttggctaggccggagattatcctcaac
cactgtgctcctggaactgaaacgaaatgtctgaagccccagctgcctcttgaggtagat
gtgaactgcctgcccgaaccaaacggggttggagggggcatctctgactctagctcccaa
ggtcagaattttgaaacctgttcccctctctctgaagacattggttcaaagctggactca
tgggaggaacacatcttttctgcctttggtaacttttga

DBGET integrated database retrieval system