KEGG   Homo sapiens (human): 84879
Entry
84879             CDS       T01001                                 

Symbol
MFSD2A, MCPH15, MFSD2, NEDMISBA, NLS1, SLC59A1
Name
(RefSeq) major facilitator superfamily domain containing 2A
  KO
K23894  sodium-dependent lysophosphatidylcholine symporter 1
Organism
hsa  Homo sapiens (human)
Disease
H00269  Primary microcephaly
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    84879 (MFSD2A)
Transporters [BR:hsa02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   84879 (MFSD2A)
SSDB
Motif
Pfam: MFS_2 MP_p6
Other DBs
NCBI-GeneID: 84879
NCBI-ProteinID: NP_001129965
OMIM: 614397
HGNC: 25897
Ensembl: ENSG00000168389
Vega: OTTHUMG00000009293
Pharos: Q8NA29(Tbio)
UniProt: Q8NA29 Q71RE4
Position
1:39955145..39969956
AA seq 543 aa
MAKGEGAESGSAAGLLPTSILQSTERPAQVKKEPKKKKQQLSVCNKLCYALGGAPYQVTG
CALGFFLQIYLLDVAQKDEEVVFCFSSFQVGPFSASIILFVGRAWDAITDPLVGLCISKS
PWTCLGRLMPWIIFSTPLAVIAYFLIWFVPDFPHGQTYWYLLFYCLFETMVTCFHVPYSA
LTMFISTEQTERDSATAYRMTVEVLGTVLGTAIQGQIVGQADTPCFQDLNSSTVASQSAN
HTHGTTSHRETQKAYLLAAGVIVCIYIICAVILILGVREQREPYEAQQSEPIAYFRGLRL
VMSHGPYIKLITGFLFTSLAFMLVEGNFVLFCTYTLGFRNEFQNLLLAIMLSATLTIPIW
QWFLTRFGKKTAVYVGISSAVPFLILVALMESNLIITYAVAVAAGISVAAAFLLPWSMLP
DVIDDFHLKQPHFHGTEPIFFSFYVFFTKFASGVSLGISTLSLDFAGYQTRGCSQPERVK
FTLNMLVTMAPIVLILLGLLLFKMYPIDEERRRQNKKALQALRDEASSSGCSETDSTELA
SIL
NT seq 1632 nt   +upstreamnt  +downstreamnt
atggccaaaggagaaggcgccgagagcggctccgcggcggggctgctacccaccagcatc
ctccaaagcactgaacgcccggcccaggtgaagaaagaaccgaaaaagaagaaacaacag
ttgtctgtttgcaacaagctttgctatgcacttgggggagccccctaccaggtgacgggc
tgtgccctgggtttcttccttcagatctacctattggatgtggctcagaaggatgaggaa
gttgtcttttgcttctcctcattccaggtgggccctttctctgcctccatcatcctgttt
gtgggccgagcctgggatgccatcacagaccccctggtgggcctctgcatcagcaaatcc
ccctggacctgcctgggtcgccttatgccctggatcatcttctccacgcccctggccgtc
attgcctacttcctcatctggttcgtgcccgacttcccacacggccagacctattggtac
ctgcttttctattgcctctttgaaacaatggtcacgtgtttccatgttccctactcggct
ctcaccatgttcatcagcaccgagcagactgagcgggattctgccaccgcctatcggatg
actgtggaagtgctgggcacagtgctgggcacggcgatccagggacaaatcgtgggccaa
gcagacacgccttgtttccaggacctcaatagctctacagtagcttcacaaagtgccaac
catacacatggcaccacctcacacagggaaacgcaaaaggcatacctgctggcagcgggg
gtcattgtctgtatctatataatctgtgctgtcatcctgatcctgggcgtgcgggagcag
agagaaccctatgaagcccagcagtctgagccaatcgcctacttccggggcctacggctg
gtcatgagccacggcccatacatcaaacttattactggcttcctcttcacctccttggct
ttcatgctggtggaggggaactttgtcttgttttgcacctacaccttgggcttccgcaat
gaattccagaatctactcctggccatcatgctctcggccactttaaccattcccatctgg
cagtggttcttgacccggtttggcaagaagacagctgtatatgttgggatctcatcagca
gtgccatttctcatcttggtggccctcatggagagtaacctcatcattacatatgcggta
gctgtggcagctggcatcagtgtggcagctgccttcttactaccctggtccatgctgcct
gatgtcattgacgacttccatctgaagcagccccacttccatggaaccgagcccatcttc
ttctccttctatgtcttcttcaccaagtttgcctctggagtgtcactgggcatttctacc
ctcagtctggactttgcagggtaccagacccgtggctgctcgcagccggaacgtgtcaag
tttacactgaacatgctcgtgaccatggctcccatagttctcatcctgctgggcctgctg
ctcttcaaaatgtaccccattgatgaggagaggcggcggcagaataagaaggccctgcag
gcactgagggacgaggccagcagctctggctgctcagaaacagactccacagagctggct
agcatcctctag

DBGET integrated database retrieval system