KEGG   Homo sapiens (human): 84908Help
Entry
84908             CDS       T01001                                 

Gene name
FAM136A
Definition
(RefSeq) family with sequence similarity 136 member A
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF842 DUF411
Motif
Other DBs
NCBI-GeneID: 84908
NCBI-ProteinID: NP_116211
OMIM: 616275
HGNC: 25911
Ensembl: ENSG00000035141
Vega: OTTHUMG00000129668
Pharos: Q96C01(Tdark)
UniProt: Q96C01
Position
2p13.3
AA seq 138 aa AA seqDB search
MAELQQLRVQEAVESMVKSLERENIRKMQGLMFRCSASCCEDSQASMKQVHQCIERCHVP
LAQAQALVTSELEKFQDRLARCTMHCNDKAKDSIDAGSKELQVKQQLDSCVTKCVDDHMH
LIPTMTKKMKEALLSIGK
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atggctgagctgcagcagctccgggtgcaggaggcggtggagtccatggtgaagagtctg
gaaagagagaacatccggaagatgcagggtctcatgttccggtgcagcgccagctgttgt
gaggacagccaggcctccatgaagcaggtgcaccagtgcatcgagcgctgccatgtgcct
ctggctcaagcccaggctttggtcaccagtgagctggagaagttccaggaccgcctggcc
cggtgcaccatgcattgcaacgacaaagccaaagattcaatagatgctgggagtaaggag
cttcaggtgaagcagcagctggacagttgtgtgaccaagtgtgtggatgaccacatgcac
ctcatcccaactatgaccaagaagatgaaggaggctctcttatcaattggaaaataa

DBGET integrated database retrieval system