KEGG   Homo sapiens (human): 84988
Entry
84988             CDS       T01001                                 
Symbol
PPP1R16A, MYPT3
Name
(RefSeq) protein phosphatase 1 regulatory subunit 16A
  KO
K17458  protein phosphatase 1 regulatory subunit 16A
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    84988 (PPP1R16A)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     84988 (PPP1R16A)
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank Ank_5 Ank_3
Other DBs
NCBI-GeneID: 84988
NCBI-ProteinID: NP_001316371
OMIM: 609172
HGNC: 14941
Ensembl: ENSG00000160972
Pharos: Q96I34(Tdark)
UniProt: Q96I34
Position
8:144477982..144502121
AA seq 528 aa
MAEHLELLAEMPMVGRMSTQERLKHAQKRRAQQVKMWAQAEKEAQGKKGPGERPRKEAAS
QGLLKQVLFPPSVVLLEAAARNDLEEVRQFLGSGVSPDLANEDGLTALHQCCIDDFREMV
QQLLEAGANINACDSECWTPLHAAATCGHLHLVELLIASGANLLAVNTDGNMPYDLCDDE
QTLDCLETAMADRGITQDSIEAARAVPELRMLDDIRSRLQAGADLHAPLDHGATLLHVAA
ANGFSEAAALLLEHRASLSAKDQDGWEPLHAAAYWGQVPLVELLVAHGADLNAKSLMDET
PLDVCGDEEVRAKLLELKHKHDALLRAQSRQRSLLRRRTSSAGSRGKVVRRVSLTQRTDL
YRKQHAQEAIVWQQPPPTSPEPPEDNDDRQTGAELRPPPPEEDNPEVVRPHNGRVGGSPV
RHLYSKRLDRSVSYQLSPLDSTTPHTLVHDKAHHTLADLKRQRAAAKLQRPPPEGPESPE
TAEPGLPGDTVTPQPDCGFRAGGDPPLLKLTAPAVEAPVERRPCCLLM
NT seq 1587 nt   +upstreamnt  +downstreamnt
atggccgagcacctggagctgctggcagagatgcccatggtgggcaggatgagcacacag
gagcggctgaagcatgcccagaagcggcgcgcccagcaggtgaagatgtgggcccaggct
gagaaggaggcccagggcaagaagggtcctggggagcgtccccggaaggaggcagccagc
caagggctcctgaagcaggtcctcttccctcccagtgttgtccttctggaggccgctgcc
cgaaatgacctggaagaagtccgccagttccttgggagtggggtcagccctgacttggcc
aacgaggacggcctgacggccctgcaccagtgctgcattgatgatttccgagagatggtg
cagcagctcctggaggctggggccaacatcaatgcctgtgacagtgagtgctggacgcct
ctgcatgctgcggccacctgcggccacctgcacctggtggagctgctcatcgccagtggc
gccaatctcctggcggtcaacaccgacgggaacatgccctatgacctgtgtgatgatgag
cagacgctggactgcctggagactgccatggccgaccgtggcatcacccaggacagcatc
gaggccgcccgggccgtgccagaactgcgcatgctggacgacatccggagccggctgcag
gccggggcagacctccatgcccccctggaccacggggccacgctgctgcacgtcgcagcc
gccaacgggttcagcgaggcggctgccctgctgctggaacaccgagccagcctgagcgct
aaggaccaagacggctgggagccgctgcacgccgcggcctactggggccaggtgcccctg
gtggagctgctcgtggcgcacggggccgacctgaacgcaaagtccctgatggacgagacg
ccccttgatgtgtgcggggacgaggaggtgcgggccaagctgctggagctgaagcacaag
cacgacgccctcctgcgcgcccagagccgccagcgctccttgctgcgccgccgcacctcc
agcgccggcagccgcgggaaggtggtgaggcgggtgagcctaacccagcgcaccgacctg
taccgcaagcagcacgcccaggaggccatcgtgtggcaacagccgccgcccaccagcccg
gagccgcccgaggacaacgatgaccgccagacaggcgcagagctcaggccgccgcccccg
gaggaggacaaccccgaagtggtcaggccgcacaatggccgagtagggggctccccagtg
cggcatctatactccaagcgactagaccggagtgtctcctaccagctgagccccctggac
agcaccaccccccacaccctggtccacgacaaggcccaccacaccctggctgacctgaag
cgccagcgagctgctgccaagctgcagcgacccccacctgaggggcccgagagccctgag
acagctgagcctggcctgcctggtgacacggtgaccccccagcctgactgtggcttcagg
gcaggcggggacccacccctgctcaagctcacagccccggcggtggaggctcccgtggag
aggaggccgtgctgcctgctcatgtga

DBGET integrated database retrieval system