KEGG   Homo sapiens (human): 85865Help
Entry
85865             CDS       T01001                                 

Gene name
GTPBP10, ObgH2, UG0751c10
Definition
(RefSeq) GTP binding protein 10
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: MMR_HSR1 GTP1_OBG FeoB_N MeaB GTP_EFTU Arf MnmE_helical MMR_HSR1_Xtn
Motif
Other DBs
NCBI-GeneID: 85865
NCBI-ProteinID: NP_149098
OMIM: 610920
HGNC: 25106
Ensembl: ENSG00000105793
Vega: OTTHUMG00000023655
Pharos: A4D1E9(Tdark)
UniProt: A4D1E9
Position
7q21.13
AA seq 387 aa AA seqDB search
MVHCSCVLFRKYGNFIDKLRLFTRGGSGGMGYPRLGGEGGKGGDVWVVAQNRMTLKQLKD
RYPRKRFVAGVGANSKISALKGSKGKDCEIPVPVGISVTDENGKIIGELNKENDRILVAQ
GGLGGKLLTNFLPLKGQKRIIHLDLKLIADVGLVGFPNAGKSSLLSCVSHAKPAIADYAF
TTLKPELGKIMYSDFKQISVADLPGLIEGAHMNKGMGHKFLKHIERTRQLLFVVDISGFQ
LSSHTQYRTAFETIILLTKELELYKEELQTKPALLAVNKMDLPDAQDKFHELMSQLQNPK
DFLHLFEKNMIPERTVEFQHIIPISAVTGEGIEELKNCIRKSLDEQANQENDALHKKQLL
NLWISDTMSSTEPPSKHAVTTSKMDII
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggtgcattgcagttgcgtgttgttcagaaagtatggaaatttcatcgataagctaaga
ctcttcaccaggggaggatccggtggaatgggttatcctcgtttaggtggagaaggtgga
aaaggtggtgatgtctgggttgtagcccagaacagaatgactttaaaacaacttaaagac
aggtatcctcggaaacggtttgtggctggagtaggagcaaacagcaaaattagtgcactg
aaaggctccaaaggaaaagactgtgaaatccctgtgcctgtgggtatttcagtaactgat
gaaaatggtaaaattataggagaactcaataaagaaaatgacagaattttggtagctcaa
ggaggtcttggtggtaaattacttacaaatttcttaccattgaaaggccagaaacgaata
attcaccttgatctaaaacttatagctgatgtaggcctagtaggattcccaaatgctgga
aaatcctctttgctaagttgtgtttctcatgcaaaacctgcaattgcagattacgcattt
acaacattaaagcctgaacttggaaagataatgtacagtgatttcaaacagatatcagta
gctgatcttccgggtttaatagaaggagcacatatgaacaaaggaatgggccacaaattc
ctcaagcatatagaaagaactagacaactactttttgttgttgatatttctggatttcag
ctttcttctcacactcaatacaggacagcttttgaaaccataatactgcttacaaaagag
ttggaattgtacaaagaggaacttcagacaaaacctgcactcttggcagttaataaaatg
gacttgccagatgcccaagataagttccatgaattgatgagccagctccagaatcctaaa
gattttctgcatttatttgaaaaaaacatgattccagagaggactgtagagttccaacat
atcatccccatatctgcagttactggagaaggaatcgaagaattaaagaattgtataaga
aagtcactggatgaacaggccaaccaggaaaatgatgcacttcataagaaacagttgctt
aatttgtggatttctgatacaatgtcttctactgagccaccatcaaagcatgctgttact
acttccaaaatggatataatttaa

DBGET integrated database retrieval system