KEGG   Homo sapiens (human): 8724Help
Entry
8724              CDS       T01001                                 

Gene name
SNX3, Grd19, MCOPS8, SDP3
Definition
(RefSeq) sorting nexin 3
  KO
K17918  sorting nexin-3/12
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    8724 (SNX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PX
Motif
Other DBs
NCBI-GeneID: 8724
NCBI-ProteinID: NP_003786
OMIM: 605930
HGNC: 11174
Ensembl: ENSG00000112335
Vega: OTTHUMG00000015323
Pharos: O60493(Tbio)
UniProt: O60493
Structure
PDB: 

Position
6q21
AA seq 162 aa AA seqDB search
MAETVADTRRLITKPQNLNDAYGPPSNFLEIDVSNPQTVGVGRGRFTTYEIRVKTNLPIF
KLKESTVRRRYSDFEWLRSELERESKVVVPPLPGKAFLRQLPFRGDDGIFDDNFIEERKQ
GLEQFINKVAGHPLAQNERCLHMFLQDEIIDKSYTPSKIRHA
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atggcggagaccgtggctgacacccggcggctgatcaccaagccgcagaacctgaatgac
gcctacggaccccccagcaacttcctcgagatcgatgtgagcaacccgcaaacggtgggg
gtcggccggggccgcttcaccacttacgaaatcagggtcaagacaaatcttcctattttc
aagctgaaagaatctactgttagaagaagatacagtgactttgaatggctgcgaagtgaa
ttagaaagagagagcaaggtcgtagttcccccgctccctgggaaagcgtttttgcgtcag
cttccttttagaggagatgatggaatatttgatgacaattttattgaggaaagaaaacaa
gggctggagcagtttataaacaaggtcgctggtcatcctctggcacagaacgaacgttgt
cttcacatgtttttacaagatgaaataatagataaaagctatactccatctaaaataaga
catgcctga

DBGET integrated database retrieval system