KEGG   Homo sapiens (human): 8789
Entry
8789              CDS       T01001                                 

Gene name
FBP2
Definition
(RefSeq) fructose-bisphosphatase 2
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00030  Pentose phosphate pathway
hsa00051  Fructose and mannose metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa04152  AMPK signaling pathway
hsa04910  Insulin signaling pathway
hsa04922  Glucagon signaling pathway
Module
hsa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    8789 (FBP2)
   00030 Pentose phosphate pathway
    8789 (FBP2)
   00051 Fructose and mannose metabolism
    8789 (FBP2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    8789 (FBP2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    8789 (FBP2)
   04922 Glucagon signaling pathway
    8789 (FBP2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8789 (FBP2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     8789 (FBP2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   8789 (FBP2)
SSDB
Motif
Pfam: FBPase FBPase_C Inositol_P ABC2_membrane
Other DBs
NCBI-GeneID: 8789
NCBI-ProteinID: NP_003828
OMIM: 603027
HGNC: 3607
Ensembl: ENSG00000130957
Vega: OTTHUMG00000020269
Pharos: O00757(Tbio)
UniProt: O00757
Structure
PDB: 

Position
9q22.32
AA seq 339 aa
MTDRSPFETDMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSAVRKAGLAHLYGI
AGSVNVTGDEVKKLDVLSNSLVINMVQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDP
LDGSSNIDCLASIGTIFAIYRKTSEDEPSEKDALQCGRNIVAAGYALYGSATLVALSTGQ
GVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATTEYVQKKKFPEDGSAP
YGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGT
QPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQAGS
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgacggacagaagccccttcgaaaccgacatgctcaccctgacccgctacgttatggaa
aaggggcgtcaggccaaagggactggggagctcacccagctgctgaactcaatgctgacg
gccatcaaagccatctcctcggctgtgcgcaaggccggtctggcccacctgtatggaatc
gcaggaagcgttaacgtgacgggagatgaggtgaagaaactggatgtgctatccaattcc
ctggtgatcaacatggtccaatcctcctatagtacctgcgtcctggtctcagaagagaat
aaggacgccatcatcaccgccaaggagaagcgggggaaatacgtggtctgctttgaccca
ctggatggatcttccaatattgactgcctggcctccatcggaaccatctttgccatctat
agaaagacctcagaggatgagccttctgaaaaggatgccctgcagtgtggccgcaatatt
gtggccgcaggttatgcgctgtacggtagtgcaaccctggtggctctctccacagggcaa
ggcgtggacctcttcatgcttgacccggctcttggtgaatttgtcctggtggaaaaagat
gtcaagattaagaagaaaggaaagatttacagcctgaatgagggctatgccaagtatttt
gatgcggccaccactgaatatgtgcagaaaaagaaattccctgaggatggcagtgctccc
tatggggccaggtatgtgggctccatggtggctgacgtgcaccgcaccctggtctatgga
ggaatcttcctgtacccagccaaccagaagagccctaagggcaagctccggctcctgtat
gaatgcaatcccgtggcctacatcattgagcaggcaggaggcttggcgaccacggggacc
cagcctgtactggacgtgaagcccgaggcaattcaccagcgagtccccctcattctgggg
tcaccagaggatgtgcaggaatatctcacctgtgtgcagaaaaatcaggcaggcagctag

DBGET integrated database retrieval system