KEGG   Homo sapiens (human): 8858Help
Entry
8858              CDS       T01001                                 

Gene name
PROZ, PZ
Definition
(RefSeq) protein Z, vitamin K dependent plasma glycoprotein
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Gla FXa_inhibition EGF cEGF EGF_CA hEGF EGF_3
Motif
Other DBs
NCBI-GeneID: 8858
NCBI-ProteinID: NP_003882
OMIM: 176895
HGNC: 9460
Ensembl: ENSG00000126231
Vega: OTTHUMG00000017376
Pharos: P22891(Tbio)
UniProt: P22891
Structure
PDB: 

Position
13q34
AA seq 400 aa AA seqDB search
MAGCVPLLQGLVLVLALHRVEPSVFLPASKANDVLVRWKRAGSYLLEELFEGNLEKECYE
EICVYEEAREVFENEVVTDEFWRRYKGGSPCISQPCLHNGSCQDSIWGYTCTCSPGYEGS
NCELAKNECHPERTDGCQHFCLPGQESYTCSCAQGYRLGEDHKQCVPHDQCACGVLTSEK
RAPDLQDLPWQVKLTNSEGKDFCGGVIIRENFVLTTAKCSLLHRNITVKTYFNRTSQDPL
MIKITHVHVHMRYDADAGENDLSLLELEWPIQCPGAGLPVCTPEKDFAEHLLIPRTRGLL
SGWARNGTDLGNSLTTRPVTLVEGEECGQVLNVTVTTRTYCERSSVAAMHWMDGSVVTRE
HRGSWFLTGVLGSQPVGGQAHMVLVTKVSRYSLWFKQIMN
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcaggctgcgtcccactgctccagggcctggtcctggtcctcgccctccatcgtgtg
gagccctcagtatttctcccggcctccaaagcaaacgacgttctggtgaggtggaagcgt
gcgggctcctatcttctggaagaactcttcgagggaaacttggaaaaagaatgttatgaa
gaaatctgtgtctatgaagaagcaagagaagtgtttgaaaatgaagtagtcactgatgaa
ttctggagacgatataagggcggctccccgtgcatctcccagccctgcctccacaacggc
tcttgccaggacagcatctggggctacacctgcacctgctcccccggctatgagggcagc
aactgcgagctggctaaaaatgaatgtcacccagagcggactgatgggtgtcaacacttc
tgcctcccaggacaggaatcctacacatgcagctgtgctcagggctacaggcttggtgag
gaccacaaacagtgtgtgccccacgaccagtgtgcctgcggggtgctgacctctgagaag
cgtgcaccggatctacaggacctcccgtggcaggtaaagttaacaaattccgaaggaaaa
gacttctgtggtggtgttataatacgggaaaattttgtactgacaacagcaaaatgttca
ctgttacacaggaatattactgtaaaaacatattttaacagaacgagccaagacccgctg
atgatcaagataacgcacgtccatgtgcacatgcggtatgacgcggacgcgggggagaat
gacctgtcactgctggagctggagtggcccatccagtgcccaggtgcggggctccccgtg
tgcacccctgagaaagacttcgctgagcacctcctcatcccacgcaccaggggcctcctc
agcggctgggcacgcaatggcactgacctgggcaactcgctgaccacgcggcctgtcaca
cttgtggagggggaggagtgcgggcaggtcctgaatgtgactgtcaccaccaggacctac
tgtgagagaagcagcgtggcggccatgcactggatggatggaagtgtggtcaccagagaa
cacagaggctcctggtttctcacgggggtcctgggctcgcagccagtaggagggcaggct
cacatggtccttgtcaccaaggtctccaggtactcactctggtttaaacagatcatgaac
taa

DBGET integrated database retrieval system