KEGG   Homo sapiens (human): 8861Help
Entry
8861              CDS       T01001                                 

Gene name
LDB1, CLIM-2, CLIM2, LDB-1, NLI
Definition
(RefSeq) LIM domain binding 1
  KO
K15617  LIM domain-binding protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Network
N00121  LMO2-rearrangement to transcriptional activation
N00122  LMO2-rearrangement to transcriptional repression
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    8861 (LDB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LIM_bind
Motif
Other DBs
NCBI-GeneID: 8861
NCBI-ProteinID: NP_001106878
OMIM: 603451
HGNC: 6532
Ensembl: ENSG00000198728
Vega: OTTHUMG00000018950
Pharos: Q86U70(Tbio)
UniProt: Q86U70
Structure
PDB: 

Position
10q24.32
AA seq 411 aa AA seqDB search
MSVGCACPGCSSKSFKLYSPKEPPNGNAFPPFHPGTMLDRDVGPTPMYPPTYLEPGIGRH
TPYGNQTDYRIFELNKRLQNWTEECDNLWWDAFTTEFFEDDAMLTITFCLEDGPKRYTIG
RTLIPRYFRSIFEGGATELYYVLKHPKEAFHSNFVSLDCDQGSMVTQHGKPMFTQVCVEG
RLYLEFMFDDMMRIKTWHFSIRQHRELIPRSILAMHAQDPQMLDQLSKNITRCGLSNSTL
NYLRLCVILEPMQELMSRHKTYSLSPRDCLKTCLFQKWQRMVAPPAEPTRQQPSKRRKRK
MSGGSTMSSGGGNTNNSNSKKKSPASTFALSSQVPDVMVVGEPTLMGGEFGDEDERLITR
LENTQFDAANGIDDEDSFNNSPALGANSPWNSKPPSSQESKSENPTSQASQ
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtgggctgtgcctgtcctggttgttcctcaaagtcattcaagctgtactcgccg
aaggagcccccgaacggcaacgcctttccccccttccatcccggcaccatgctggatagg
gatgtgggcccaactcccatgtatccgcctacatacctggagccagggattgggaggcac
acaccatatggcaaccaaactgactacagaatatttgagcttaacaaacggcttcagaac
tggacagaggagtgtgacaatctctggtgggatgcattcacgactgagttctttgaggat
gatgccatgttgaccatcactttctgcctggaggatggaccaaagagatataccattggc
cggaccctgatcccacgctacttccgcagcatctttgaggggggtgctacggagctgtac
tatgttcttaagcaccccaaggaggcattccacagcaactttgtgtccctcgactgtgac
cagggcagcatggtgacccagcatggcaagcccatgttcacccaggtgtgtgtggagggc
cggttgtacctggagttcatgtttgacgacatgatgcggataaagacgtggcacttcagc
atccggcagcaccgagagctcatcccccgcagcatccttgccatgcatgcccaagacccc
cagatgttggatcagctctccaaaaacatcactcggtgtgggctgtccaattccactctc
aactacctccgactctgtgtgatactcgagcccatgcaagagctcatgtcacgccacaag
acctacagcctcagcccccgcgactgcctcaagacctgccttttccagaagtggcagcgc
atggtagcaccccctgcggagcccacacgtcagcagcccagcaaacggcggaaacggaag
atgtcagggggcagcaccatgagctctggtggtggcaacaccaacaacagcaacagcaag
aagaagagcccagctagcaccttcgccctctccagccaggtacctgatgtgatggtggtg
ggggagcccaccctgatgggcggggagttcggggacgaggacgagaggctcatcacccgg
ctggagaacacccagtttgacgcagccaacggcattgacgacgaggacagctttaacaac
tcccctgcactgggcgccaacagcccctggaacagcaagcctccgtccagccaagaaagc
aaatcggagaaccccacgtcacaggcctcccagtaa

DBGET integrated database retrieval system