KEGG   Homo sapiens (human): 89822Help
Entry
89822             CDS       T01001                                 

Gene name
KCNK17, K2p17.1, TALK-2, TALK2, TASK-4, TASK4
Definition
(RefSeq) potassium two pore domain channel subfamily K member 17
  KO
K04925  potassium channel subfamily K member 17
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    89822 (KCNK17)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, two-pore domain (K2P)
   89822 (KCNK17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans_2 Ion_trans SLC3A2_N IRK
Motif
Other DBs
NCBI-GeneID: 89822
NCBI-ProteinID: NP_113648
OMIM: 607370
HGNC: 14465
Ensembl: ENSG00000124780
Vega: OTTHUMG00000014646
Pharos: Q96T54(Tbio)
UniProt: Q96T54
Position
6p21.2
AA seq 332 aa AA seqDB search
MYRPRARAAPEGRVRGCAVPSTVLLLLAYLAYLALGTGVFWTLEGRAAQDSSRSFQRDKW
ELLQNFTCLDRPALDSLIRDVVQAYKNGASLLSNTTSMGRWELVGSFFFSVSTITTIGYG
NLSPNTMAARLFCIFFALVGIPLNLVVLNRLGHLMQQGVNHWASRLGGTWQDPDKARWLA
GSGALLSGLLLFLLLPPLLFSHMEGWSYTEGFYFAFITLSTVGFGDYVIGMNPSQRYPLW
YKNMVSLWILFGMAWLALIIKLILSQLETPGRVCSCCHHSSKEDFKSQSWRQGPDREPES
HSPQQGCYPEGPMGIIQHLEPSAHAAGCGKDS
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgaccgcgagcccgggcggctcccgagggcagggtccggggctgcgcggtgccc
agcaccgtgctcctgctgctcgcctacctggcttacctggcgctgggcaccggcgtgttc
tggacgctggagggccgcgcggcgcaggactccagccgcagcttccagcgcgacaagtgg
gagctgttgcagaacttcacgtgtctggaccgcccggcgctggactcgctgatccgggat
gtcgtccaagcatacaaaaacggagccagcctcctcagcaacaccaccagcatggggcgc
tgggagctcgtgggctccttcttcttttctgtgtccaccatcaccaccattggctatggc
aacctgagccccaacacgatggctgcccgcctcttctgcatcttctttgcccttgtgggg
atcccactcaacctcgtggtgctcaaccgactggggcatctcatgcagcagggagtaaac
cactgggccagcaggctggggggcacctggcaggatcctgacaaggcgcggtggctggcg
ggctctggcgccctcctctcgggcctcctgctcttcctgctgctgccaccgctgctcttc
tcccacatggagggctggagctacacagagggcttctacttcgccttcatcaccctcagc
accgtgggcttcggcgactacgtgattggaatgaacccctcccagaggtacccactgtgg
tacaagaacatggtgtccctgtggatcctctttgggatggcatggctggccttgatcatc
aaactcatcctctcccagctggagacgccagggagggtatgttcctgctgccaccacagc
tctaaggaagacttcaagtcccaaagctggagacagggacctgaccgggagccagagtcc
cactccccacagcaaggatgctatccagagggacccatgggaatcatacagcatctggaa
ccttctgctcacgctgcaggctgtggcaaggacagctag

DBGET integrated database retrieval system