KEGG   Homo sapiens (human): 905Help
Entry
905               CDS       T01001                                 

Gene name
CCNT2, CYCT2
Definition
(RefSeq) cyclin T2
  KO
K15188  cyclin T
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00119  MLL-AF4 fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    905 (CCNT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    905 (CCNT2)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Super elongation complex (SEC)
     905 (CCNT2)
    Brd4/P-TEFb complex
     905 (CCNT2)
    7SK RNP complex
     905 (CCNT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N
Motif
Other DBs
NCBI-GeneID: 905
NCBI-ProteinID: NP_490595
OMIM: 603862
HGNC: 1600
Ensembl: ENSG00000082258
Vega: OTTHUMG00000131712
Pharos: O60583(Tbio)
UniProt: O60583 B4DH21
Structure
PDB: 

Position
2q21.3
AA seq 730 aa AA seqDB search
MASGRGASSRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINT
AIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHACLHPLEPLLDT
KCDAYLQQTQELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNS
LHLTTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVDPTVTLELLDELTHEF
LQILEKTPNRLKKIRNWRANQAARKPKVDGQVSETPLLGSSLVQNSILVDSVTGVPTNPS
FQKPSTSAFPAPVPLNSGNISVQDSHTSDNLSMLATGMPSTSYGLSSHQEWPQHQDSART
EQLYSQKQETSLSGSQYNINFQQGPSISLHSGLHHRPDKISDHSSVKQEYTHKAGSSKHH
GPISTTPGIIPQKMSLDKYREKRKLETLDLDVRDHYIAAQVEQQHKQGQSQAASSSSVTS
PIKMKIPIANTEKYMADKKEKSGSLKLRIPIPPTDKSASKEELKMKIKVSSSERHSSSDE
GSGKSKHSSPHISRDHKEKHKEHPSSRHHTSSHKHSHSHSGSSSGGSKHSADGIPPTVLR
SPVGLSSDGISSSSSSSRKRLHVNDASHNHHSKMSKSSKSSGSSSSSSSSVKQYISSHNS
VFNHPLPPPPPVTYQVGYGHLSTLVKLDKKPVETNGPDANHEYSTSSQHMDYKDTFDMLD
SLLSAQGMNM
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgggccgtggagcttcttctcgctggttctttactcgggaacagctggagaac
acgccgagccgccgctgcggagtggaggcggataaagagctctcgtgccgccagcaggcg
gccaacctcatccaggagatgggacagcgtctcaatgtctctcagcttacaataaacact
gcgattgtttatatgcacaggttttatatgcaccattctttcaccaaattcaacaaaaat
ataatatcgtctactgcattatttttggctgcaaaagtggaagaacaggctcgaaaactt
gaacatgttatcaaagtagcacatgcttgtcttcatcctctagagccactgctggatact
aaatgtgatgcttaccttcaacagactcaagaactggttatacttgaaaccataatgcta
caaactctaggttttgagatcaccattgaacacccacacacagatgtggtgaaatgtacc
cagttagtaagagcaagcaaggatttggcacagacatcctatttcatggctaccaacagt
ctgcatcttacaaccttctgtcttcagtacaaaccaacagtgatagcatgtgtatgcatt
catttggcttgcaaatggtccaattgggagatccctgtatcaactgatggaaagcattgg
tgggaatatgtggatcctacagttactctagaattattagatgagctaacacatgagttt
ctacaaatattggagaaaacgcctaataggttgaagaagattcgaaactggagggctaat
caggcagctaggaaaccaaaagtagatggacaggtatcagagacaccacttcttggttca
tctttggtccagaattccattttagtagatagtgtcactggtgtgcctacaaacccaagt
tttcagaaaccatctacatcagcattccctgcgccagtacctctaaattcaggaaatatt
tctgttcaagacagccatacatctgataatttgtcaatgctagcaacaggaatgccaagt
acttcatacggtttatcatcacaccaggaatggcctcaacatcaagactcagcaaggaca
gaacagctatattcacagaaacaggagacatctttgtctggtagccagtacaacatcaac
ttccagcagggaccttctatatcactgcattcaggattacatcacagacctgacaaaatt
tcagatcattcttctgttaagcaagaatatactcataaagcagggagcagtaaacaccat
gggccaatttccactactccaggaataattcctcagaaaatgtctttagataaatataga
gaaaagcgtaaactagaaactcttgatctcgatgtaagggatcattatatagctgcccag
gtagaacagcagcacaaacaagggcagtcacaggcagccagcagcagttctgttacttct
cccattaaaatgaaaatacctatcgcaaatactgaaaaatacatggcagacaaaaaggaa
aagagtgggtcactgaaattacggattccaataccacccactgataaaagcgccagtaaa
gaagaactgaaaatgaaaataaaagtttcttcttcagaaagacacagctcttctgatgaa
ggcagtgggaagagcaaacattcaagcccacatattagcagagaccataaggagaagcac
aaggagcatccttcaagccgccaccacaccagcagccacaagcattcccactcgcatagt
ggcagcagcagcggtggcagtaaacacagtgccgacggaataccacccactgttctgagg
agtcctgttggcctgagcagtgatggcatttcctctagctccagctcttcaaggaagagg
ctgcatgtcaatgatgcatctcacaaccaccactccaaaatgagcaaaagttccaaaagt
tcaggtagttcatctagttcttcctcctctgttaagcagtatatatcctctcacaactct
gtttttaaccatcccttaccccctcctccccctgtcacataccaggtgggctacggacat
ctcagcaccctcgtgaaactggacaagaagccagtggagaccaacggtcctgatgccaat
cacgagtacagtacaagcagccagcatatggactacaaagacacattcgacatgctggac
tcactgttaagtgcccaaggaatgaacatgtaa

DBGET integrated database retrieval system