KEGG   Homo sapiens (human): 91875
Entry
91875             CDS       T01001                                 
Symbol
TTC5, NEDCAFD, Strap
Name
(RefSeq) tetratricopeptide repeat domain 5
  KO
K24928  tetratricopeptide repeat protein 5
Organism
hsa  Homo sapiens (human)
Disease
H02535  Neurodevelopmental disorder with dysmorphic facies
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    91875 (TTC5)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   Others
    91875 (TTC5)
SSDB
Motif
Pfam: TTC5_OB TPR_11 TPR_2 TPR_1 TPR_16 TPR_19 TPR_17 TPR_14 TPR_8 TPR_9 Sec16_C TPR_12 RPN7 NatA_aux_su TPR-S DUF6584
Other DBs
NCBI-GeneID: 91875
NCBI-ProteinID: NP_612385
OMIM: 619014
HGNC: 19274
Ensembl: ENSG00000136319
Pharos: Q8N0Z6(Tbio)
UniProt: Q8N0Z6 Q86T04
Structure
Position
14:complement(20286227..20305951)
AA seq 440 aa
MMADEEEEVKPILQKLQELVDQLYSFRDCYFETHSVEDAGRKQQDVQKEMEKTLQQMEEV
VGSVQGKAQVLMLTGKALNVTPDYSPKAEELLSKAVKLEPELVEAWNQLGEVYWKKGDVA
AAHTCFSGALTHCRNKVSLQNLSMVLRQLRTDTEDEHSHHVMDSVRQAKLAVQMDVHDGR
SWYILGNSYLSLYFSTGQNPKISQQALSAYAQAEKVDRKASSNPDLHLNRATLHKYEESY
GEALEGFSRAAALDPAWPEPRQREQQLLEFLDRLTSLLESKGKVKTKKLQSMLGSLRPAH
LGPCSDGHYQSASGQKVTLELKPLSTLQPGVNSGAVILGKVVFSLTTEEKVPFTFGLVDS
DGPCYAVMVYNIVQSWGVLIGDSVAIPEPNLRLHRIQHKGKDYSFSSVRVETPLLLVVNG
KPQGSSSQAVATVASRPQCE
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgatggctgatgaagaggaagaagtcaagccgatcttgcagaaattgcaggaactcgtg
gatcagctctactcatttcgagactgctatttcgagacacatagtgttgaggatgctggg
aggaagcaacaggatgtgcagaaggagatggagaaaaccctacagcagatggaagaagta
gtgggttctgtccagggcaaggcacaagttctaatgctaactgggaaagcactaaatgtg
actcctgactatagccctaaggctgaggagcttctgtcaaaggctgtgaagctggagccc
gagctggtggaagcctggaaccagctgggtgaggtgtactggaaaaaaggggatgttgca
gctgcccacacctgcttctcaggagccctcacccattgcaggaacaaagtctccttgcaa
aacctgtcaatggtgcttcgtcagctgcggactgacactgaagatgaacattctcaccat
gtcatggacagtgtccgacaggctaagttggctgttcagatggatgtccatgatggccgc
tcctggtatattcttgggaattcatatctttccctttacttctctactggccagaaccct
aagatctcccagcaagccctcagtgcctatgcccaagcagagaaagttgacagaaaagct
tctagcaatcctgaccttcatctgaacagggcgacgttgcataaatatgaagagagttat
ggggaggccctggagggcttctctcgggctgcagccctggaccctgcctggccagagccc
cggcaacgagagcaacaacttctggaattcctggatagattaaccagcctccttgagagt
aagggaaaggtgaagaccaaaaagctgcagagcatgctgggaagcttgcgcccagcccat
ctaggcccttgcagtgatgggcactatcagtcagcctctgggcagaaagtgaccctggag
ctcaagccactgagtacgcttcagcctggggtgaacagcggtgccgtcatcctgggaaag
gtggtatttagcctcaccacagaggagaaagtcccctttacatttggcctggtagattca
gatggaccttgctatgcagtgatggtgtacaatatagtgcagagctggggagtgctcatt
ggagactctgtagccattcctgagcccaacctgcggcttcaccgaattcagcacaaagga
aaggactattccttttccagtgttcgagtggagacgcccctcctgctagtggtgaatggg
aagcctcagggatccagcagccaggctgttgccacagtggcatcgcgaccacagtgtgaa
tga

DBGET integrated database retrieval system