KEGG   Homo sapiens (human): 92483
Entry
92483             CDS       T01001                                 
Symbol
LDHAL6B, LDH6B, LDHAL6, LDHL
Name
(RefSeq) lactate dehydrogenase A like 6B
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00270  Cysteine and methionine metabolism
hsa00620  Pyruvate metabolism
hsa00640  Propanoate metabolism
hsa01100  Metabolic pathways
hsa04066  HIF-1 signaling pathway
hsa04922  Glucagon signaling pathway
hsa05230  Central carbon metabolism in cancer
Network
nt06017  Glycogen metabolism
  Element
N00731  Glycolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    92483 (LDHAL6B)
   00620 Pyruvate metabolism
    92483 (LDHAL6B)
   00640 Propanoate metabolism
    92483 (LDHAL6B)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    92483 (LDHAL6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    92483 (LDHAL6B)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    92483 (LDHAL6B)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    92483 (LDHAL6B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    92483 (LDHAL6B)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     92483 (LDHAL6B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   92483 (LDHAL6B)
  Exosomal proteins of breast milk
   92483 (LDHAL6B)
SSDB
Motif
Pfam: Ldh_1_N Ldh_1_C Glyco_hydro_4 UDPG_MGDP_dh_N
Other DBs
NCBI-GeneID: 92483
NCBI-ProteinID: NP_149972
HGNC: 21481
Ensembl: ENSG00000171989
Pharos: Q9BYZ2(Tbio)
UniProt: Q9BYZ2 A0A140VJM9
Position
15:59206843..59208588
AA seq 381 aa
MSWTVPVVRASQRVSSVGANFLCLGMALCPRQATRIPLNGTWLFTPVSKMATVKSELIER
FTSEKPVHHSKVSIIGTGSVGMACAISILLKGLSDELALVDLDEDKLKGETMDLQHGSPF
TKMPNIVCSKDYFVTANSNLVIITAGARQEKGETRLNLVQRNVAIFKLMISSIVQYSPHC
KLIIVSNPVDILTYVAWKLSAFPKNRIIGSGCNLDTARFRFLIGQKLGIHSESCHGWILG
EHGDSSVPVWSGVNIAGVPLKDLNSDIGTDKDPEQWKNVHKEVTATAYEIIKMKGYTSWA
IGLSVADLTESILKNLRRIHPVSTIIKGLYGIDEEVFLSIPCILGENGITNLIKIKLTPE
EEAHLKKSAKTLWEIQNKLKL
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgagttggactgtgcctgttgtgcgggccagccagagagtgagctcggtgggagcgaat
ttcctatgcctggggatggccctgtgtccgcgtcaagcaacgcgcatcccgctcaacggc
acctggctcttcacccccgtgagcaagatggcgactgtgaagagtgagcttattgagcgt
ttcacttccgagaagcccgttcatcacagtaaggtctccatcataggaactggatcggtg
ggcatggcctgcgctatcagcatcttattaaaaggcttgagtgatgaacttgcccttgtg
gatcttgatgaagacaaactgaagggtgagacgatggatcttcaacatggcagccctttc
acgaaaatgccaaatattgtttgtagcaaagattactttgtcacagcaaactccaaccta
gtgattatcacagcaggtgcacgccaagaaaagggagaaacgcgccttaatttagtccag
cgaaatgtggccatcttcaagttaatgatttccagtattgtccagtacagcccccactgc
aaactgattattgtttccaatccagtggatatcttaacttatgtagcttggaagttgagt
gcatttcccaaaaaccgtattattggaagcggctgtaatctggatactgctcgttttcgt
ttcttgattggacaaaagcttggtatccattctgaaagctgccatggatggatcctcgga
gagcatggagactcaagtgttcctgtgtggagtggagtgaacatagctggtgtccctttg
aaggatctgaactctgatataggaactgataaagatcctgagcaatggaaaaatgtccac
aaagaagtgactgcaactgcctatgagattattaaaatgaaaggttatacttcttgggcc
attggcctatctgtggccgatttaacagaaagtattttgaagaatcttaggagaatacat
ccagtttccaccataattaagggcctctatggaatagatgaagaagtattcctcagtatt
ccttgtatcctgggagagaacggtattaccaaccttataaagataaagctgacccctgaa
gaagaggcccatctgaaaaaaagtgcaaaaacactctgggaaattcagaataagcttaag
ctttaa

DBGET integrated database retrieval system