KEGG   Homo sapiens (human): 92922
Entry
92922             CDS       T01001                                 
Symbol
CCDC102A
Name
(RefSeq) coiled-coil domain containing 102A
  KO
K16759  coiled-coil domain-containing protein 102
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    92922 (CCDC102A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Other centriole associated proteins
    92922 (CCDC102A)
SSDB
Motif
Pfam: Myosin_tail_1 Taxilin DUF745 Filament THOC7 AAA_13 Crescentin NPV_P10 BRE1 Sec34 Fez1 ADIP Laminin_II
Other DBs
NCBI-GeneID: 92922
NCBI-ProteinID: NP_149989
HGNC: 28097
Ensembl: ENSG00000135736
Pharos: Q96A19(Tdark)
UniProt: Q96A19
Position
16:complement(57512181..57537016)
AA seq 550 aa
MSHGPSPRLAESPQLSKGSLLTILGSPSPERMGPADSLPPTPPSGTPSPGPPPALPLPPA
PALLADGDWESREELRLRELEEARARAAQMEKTMRRWSDCTANWREKWSKVRAERNRARE
EVRQLRQRLDALTKELAGARRERQEAQGECEARGRELARLRGARGVADQTRDGPEPEAER
EPVRDVGSERPPGSQELELVESLLKSMPEESEDCWEARSLGAGGPRGSSGRQERSRLPWE
DTAATEEEASKLTALRLRLDESQKVLLKEREDKLALSRNIEKLEGELSQWKIKYEELSKT
KQEMLKQLSILKEAHQDELGRMSEDLEDELGARSSMDRKMAELRGEMERLQAENAAEWGR
RERLETEKLGLERENKKLRAQVGDLEEALARRRRQTASALDCDLRASQAALFEKNKELAD
LKHVHGKLKKQFQEKVAELAHANRRVEQHEAEVKKLRLRVEELKKELAQAEDELDEAHNQ
ARKLQRSLDEQTEQSENLQVQLEHLQSRLRRQQQNAPLFGKIRSARFGTEEAEDGTSDLD
EDEDLQIQVA
NT seq 1653 nt   +upstreamnt  +downstreamnt
atgagccacgggcccagcccccggctggccgagtccccgcagctgtccaagggcagcctc
ctgaccatcctgggcagcccgtcgccggagcgcatggggcctgccgactccttgccgccc
acgccgcccagcggcacgccctcgcccgggccgccgcccgcactgcccctgccccccgcg
cccgcgctgctggccgacggcgactgggagagccgcgaggagctgcggctgcgggagctg
gaggaggcgcgggcgcgggcggcgcagatggagaagaccatgcgccggtggtcggactgc
actgccaattggcgcgagaaatggagcaaggtgcgcgctgagcgcaaccgcgcgcgcgag
gaggtgcgccagctgcgccagcgcctggacgcgctcaccaaggagctggcgggcgcacgg
cgcgagcgccaagaggcgcagggcgagtgcgaggcacggggccgcgagctggcgcggctg
aggggcgcccggggggtcgccgaccagacgcgcgacggccccgagccggaagcggagcgc
gagccagtgcgtgacgtcgggtccgagaggccgccaggcagccaggaactggagctggtg
gagagcctgctgaagagcatgccagaggagtctgaggactgctgggaggcgcgcagcctg
ggggctgggggcccgcggggcagctcaggccgccaggagcgcagccggctaccctgggag
gacacagctgccacggaggaggaggcctccaagttgaccgccctgcggctacggctggat
gagtcccagaaggtgctgctcaaggagcgagaggataaactggcgttgagcaggaacatt
gagaagctagagggggagctcagccagtggaagatcaagtatgaggagctgagcaagacc
aagcaggagatgctcaagcagctcagcatcctgaaggaggcgcaccaggacgagctgggc
cgcatgtctgaggacctggaagatgagctcggtgcacgctccagcatggaccggaaaatg
gccgagctgaggggcgagatggagcggctgcaggccgaaaacgctgcggagtggggccgc
cgggagcggctggagacagagaaactgggccttgagcgggagaacaagaagctgcgggca
caggtcggagacctggaggaggcgctggcccggcggcggcggcaaacagccagcgcactg
gactgcgacctgagggccagccaggccgcgctcttcgagaagaacaaggagctggcagac
ctgaagcatgtgcatggcaagctgaagaagcagttccaggagaaggtggcagagctggca
catgccaaccggcgggtggagcagcacgaggctgaggtgaagaagctgcggctgcgggtg
gaggagctcaagaaggagctggcccaggctgaggacgagctggacgaggcccacaaccag
gcacgtaagctgcagcggtcgctggacgagcagacggagcagagcgagaacctgcaagtg
caactggagcacctgcagtccaggctccgcaggcagcagcagaacgctcccctcttcggg
aagatccgcagtgctcgctttggcaccgaggaggccgaggatggaaccagtgacctggac
gaggacgaggacctgcaaatccaggtggcctag

DBGET integrated database retrieval system