KEGG   Homo sapiens (human): 9398
Entry
9398              CDS       T01001                                 

Symbol
CD101, EWI-101, IGSF2, V7
Name
(RefSeq) CD101 molecule
  KO
K06522  immunoglobulin superfamily, member 2/3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    9398 (CD101)
   04090 CD molecules [BR:hsa04090]
    9398 (CD101)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   9398 (CD101)
CD molecules [BR:hsa04090]
 Proteins
  9398 (CD101)
SSDB
Motif
Pfam: V-set Ig_3 ig I-set Ig_2 C2-set
Other DBs
NCBI-GeneID: 9398
NCBI-ProteinID: NP_001243035
OMIM: 604516
HGNC: 5949
Ensembl: ENSG00000134256
Vega: OTTHUMG00000012029
Pharos: Q93033(Tbio)
UniProt: Q93033
Position
1:116987997..117037481
AA seq 1021 aa
MAGISYVASFFLLLTKLSIGQREVTVQKGPLFRAEGYPVSIGCNVTGHQGPSEQHFQWSV
YLPTNPTQEVQIISTKDAAFSYAVYTQRVRSGDVYVERVQGNSVLLHISKLQMKDAGEYE
CHTPNTDEKYYGSYSAKTNLIVIPDTLSATMSSQTLGKEEGEPLALTCEASKATAQHTHL
SVTWYLTQDGGGSQATEIISLSKDFILVPGPLYTERFAASDVQLNKLGPTTFRLSIERLQ
SSDQGQLFCEATEWIQDPDETWMFITKKQTDQTTLRIQPAVKDFQVNITADSLFAEGKPL
ELVCLVVSSGRDPQLQGIWFFNGTEIAHIDAGGVLGLKNDYKERASQGELQVSKLGPKAF
SLKIFSLGPEDEGAYRCVVAEVMKTRTGSWQVLQRKQSPDSHVHLRKPAARSVVMSTKNK
QQVVWEGETLAFLCKAGGAESPLSVSWWHIPRDQTQPEFVAGMGQDGIVQLGASYGVPSY
HGNTRLEKMDWATFQLEITFTAITDSGTYECRVSEKSRNQARDLSWTQKISVTVKSLESS
LQVSLMSRQPQVMLTNTFDLSCVVRAGYSDLKVPLTVTWQFQPASSHIFHQLIRITHNGT
IEWGNFLSRFQKKTKVSQSLFRSQLLVHDATEEETGVYQCEVEVYDRNSLYNNRPPRASA
ISHPLRIAVTLPESKLKVNSRSQVQELSINSNTDIECSILSRSNGNLQLAIIWYFSPVST
NASWLKILEMDQTNVIKTGDEFHTPQRKQKFHTEKVSQDLFQLHILNVEDSDRGKYHCAV
EEWLLSTNGTWHKLGEKKSGLTELKLKPTGSKVRVSKVYWTENVTEHREVAIRCSLESVG
SSATLYSVMWYWNRENSGSKLLVHLQHDGLLEYGEEGLRRHLHCYRSSSTDFVLKLHQVE
MEDAGMYWCRVAEWQLHGHPSKWINQASDESQRMVLTVLPSEPTLPSRICSSAPLLYFLF
ICPFVLLLLLLISLLCLYWKARKLSTLRSNTRKEKALWVDLKEAGGVTTNRREDEEEDEG
N
NT seq 3066 nt   +upstreamnt  +downstreamnt
atggcaggcatctcatatgtggcatctttctttctccttctgactaagctcagcattggc
cagagagaagtaacagttcagaaaggaccactgtttagagctgaaggttacccagtcagc
attggctgcaatgtaactggccaccagggaccttctgagcagcatttccagtggtctgtt
tacctgccgacaaacccgacccaggaagtccagatcattagcaccaaggatgctgccttc
tcttacgcagtatatacgcagcgggtgcgaagcggagacgtctacgtggagagggtccag
ggcaactcagtcttgttgcacatctcaaaactccagatgaaggatgctggcgagtatgag
tgtcacacaccaaacactgatgagaaatactatggaagttacagtgcaaagactaatcta
attgttattccagataccctctctgccaccatgagttctcagactctcggtaaggaggaa
ggtgagccattagccctcacctgtgaggcatccaaagccacagcccaacatactcacctc
tctgtcacctggtacctaacacaggatggaggaggaagccaagccactgagattatttct
ctctccaaagattttatattggtccctgggcccttgtatacagagcggtttgcagccagt
gacgtacagctcaacaaactgggacccactacattcaggctgtccatagagaggctccag
tcctcagatcagggtcagctgttctgtgaggcaacggaatggattcaggatccagatgaa
acttggatgttcatcaccaaaaagcagaccgatcaaaccactctgaggatccagccagca
gtgaaagattttcaagtcaacattacagctgacagcttgtttgctgaagggaaaccctta
gaactggtttgcctggttgtaagcagtggccgtgacccacagcttcaaggcatttggttc
ttcaatgggactgaaattgctcacattgatgctggtggagtcctgggcctgaagaatgac
tacaaagagagagcaagtcaaggagagctccaggtttcaaagttaggccccaaggctttc
tctctcaagatcttctctctgggcccagaggatgaaggcgcctacagatgtgtggtagca
gaggtcatgaaaacacgcacaggttcctggcaggtgcttcagagaaagcagtcaccagac
agccacgtgcacctgaggaagccagcagcaagaagtgtggtcatgtctaccaagaacaag
cagcaagttgtgtgggaaggagagacactcgcctttctctgtaaggctggtggagctgaa
agtcccctgtctgtgagctggtggcacatcccacgggaccagacacagcccgagtttgtg
gctggcatggggcaggatggcattgtgcagctgggtgcctcctatggggtacccagttac
catggcaacacaaggctggagaaaatggactgggccaccttccagctggagatcaccttc
actgccatcacagacagtggcacatatgagtgcagagtatctgagaagtctcggaaccag
gccagagatctgagctggactcagaagatttcagttactgtaaagtctctggagtcaagt
ttacaagttagtctgatgagccgtcagccgcaagtgatgttaaccaacacctttgacctg
tcctgtgtcgtgagggccggttactctgacctcaaggtgccactcactgtgacgtggcag
ttccagccagctagctctcacatcttccaccagcttattcgaatcacccacaatggcact
attgaatgggggaatttcctatcccggttccaaaagaagacgaaagtgtcgcagtcttta
tttcgttcacaactcctagtccatgatgccactgaggaagagacaggagtgtatcagtgt
gaagtagaagtttatgacagaaattccctatacaacaaccgccccccgagggcttctgcc
atctctcacccactgaggatagccgtcactttaccagagagcaagctaaaagtgaattca
aggagtcaagtccaagagctctccatcaactccaacactgatatagaatgtagcatcttg
tcccggtccaatggaaaccttcagttagccattatttggtatttttctcctgtttccact
aatgcctcttggctaaagatcctggagatggaccaaaccaatgttataaaaactggggat
gagtttcacaccccacagagaaaacaaaaatttcatactgagaaggtttcccaagactta
tttcagctgcacattctgaatgtggaagacagcgatcggggcaaatatcactgtgctgtg
gaggaatggctcctgtctacaaatggcacttggcacaagcttggagaaaagaagtcagga
ctaacagaattgaaactcaagcccacaggaagtaaggtacgtgtctccaaagtgtactgg
accgaaaatgtgactgagcacagagaagtggccatccgctgcagcctggagagtgtaggc
agctcagccactctgtactctgtgatgtggtactggaacagagaaaactctggaagtaaa
ttgctggtgcacttgcaacatgatggcttgctggagtatggggaagaggggctcaggagg
cacctgcactgttaccgttcatcctctacagactttgtcctgaagcttcatcaggtggag
atggaggatgcaggaatgtactggtgtagggtggcagagtggcagctccatggacaccca
agcaagtggattaatcaagcatccgatgagtcacagcggatggtgctcacggtgctgcct
tcagagcccacgcttccttccaggatctgctcctcggcccctttactctatttcctgttc
atctgtcccttcgtcctgctcctccttctgctcatctccctcctctgcttatactggaag
gccaggaagttgtcaacactgcgttccaacacacggaaagaaaaagctctctgggtggac
ttgaaagaggctggaggtgtgaccacaaataggagggaagacgaggaggaagatgaaggc
aactga

DBGET integrated database retrieval system