KEGG   Homo sapiens (human): 9516Help
Entry
9516              CDS       T01001                                 

Gene name
LITAF, PIG7, SIMPLE, TP53I7
Definition
(RefSeq) lipopolysaccharide induced TNF factor
  KO
K19363  lipopolysaccharide-induced tumor necrosis factor-alpha factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
Disease
H00264  Charcot-Marie-Tooth disease (CMT)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    9516 (LITAF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-LITAF-like zinc_ribbon_2
Motif
Other DBs
NCBI-GeneID: 9516
NCBI-ProteinID: NP_001129944
OMIM: 603795
HGNC: 16841
Ensembl: ENSG00000189067
Vega: OTTHUMG00000177415
Pharos: Q99732(Tbio)
UniProt: Q99732
Position
16p13.13
AA seq 161 aa AA seqDB search
MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPS
YYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCG
SLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgtcggttccaggaccttaccaggcggccactgggccttcctcagcaccatccgcacct
ccatcctatgaagagacagtggctgttaacagttattaccccacacctccagctcccatg
cctgggccaactacggggcttgtgacggggcctgatgggaagggcatgaatcctccttcg
tattatacccagccagcgcccatccccaataacaatccaattaccgtgcagacggtctac
gtgcagcaccccatcacctttttggaccgccctatccaaatgtgttgtccttcctgcaac
aagatgatcgtgagtcagctgtcctataacgccggtgctctgacctggctgtcctgcggg
agcctgtgcctgctggggtgcatagcgggctgctgcttcatccccttctgcgtggatgcc
ctgcaggacgtggaccattactgtcccaactgcagagctctcctgggcacctacaagcgt
ttgtag

DBGET integrated database retrieval system