KEGG   Homo sapiens (human): 9518Help
Entry
9518              CDS       T01001                                 

Gene name
GDF15, GDF-15, MIC-1, MIC1, NAG-1, PDF, PLAB, PTGFB
Definition
(RefSeq) growth differentiation factor 15
  KO
K05504  growth differentiation factor 15
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    9518 (GDF15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    9518 (GDF15)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   9518 (GDF15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGF_beta
Motif
Other DBs
NCBI-GeneID: 9518
NCBI-ProteinID: NP_004855
OMIM: 605312
HGNC: 30142
Ensembl: ENSG00000130513
Vega: OTTHUMG00000183360
Pharos: Q99988(Tbio)
UniProt: Q99988
Structure
PDB: 

Position
19p13.11
AA seq 308 aa AA seqDB search
MPGQELRTVNGSQMLLVLLVLSWLPHGGALSLAEASRASFPGPSELHSEDSRFRELRKRY
EDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRL
HRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQLLAESSSARPQL
ELHLRPQAARGRRRARARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMC
IGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDL
LAKDCHCI
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgcccgggcaagaactcaggacggtgaatggctctcagatgctcctggtgttgctggtg
ctctcgtggctgccgcatgggggcgccctgtctctggccgaggcgagccgcgcaagtttc
ccgggaccctcagagttgcactccgaagactccagattccgagagttgcggaaacgctac
gaggacctgctaaccaggctgcgggccaaccagagctgggaagattcgaacaccgacctc
gtcccggcccctgcagtccggatactcacgccagaagtgcggctgggatccggcggccac
ctgcacctgcgtatctctcgggccgcccttcccgaggggctccccgaggcctcccgcctt
caccgggctctgttccggctgtccccgacggcgtcaaggtcgtgggacgtgacacgaccg
ctgcggcgtcagctcagccttgcaagaccccaggcgcccgcgctgcacctgcgactgtcg
ccgccgccgtcgcagtcggaccaactgctggcagaatcttcgtccgcacggccccagctg
gagttgcacttgcggccgcaagccgccagggggcgccgcagagcgcgtgcgcgcaacggg
gaccactgtccgctcgggcccgggcgttgctgccgtctgcacacggtccgcgcgtcgctg
gaagacctgggctgggccgattgggtgctgtcgccacgggaggtgcaagtgaccatgtgc
atcggcgcgtgcccgagccagttccgggcggcaaacatgcacgcgcagatcaagacgagc
ctgcaccgcctgaagcccgacacggtgccagcgccctgctgcgtgcccgccagctacaat
cccatggtgctcattcaaaagaccgacaccggggtgtcgctccagacctatgatgacttg
ttagccaaagactgccactgcatatga

DBGET integrated database retrieval system