KEGG   Homo sapiens (human): 9531
Entry
9531              CDS       T01001                                 
Symbol
BAG3, BAG-3, BIS, CAIR-1, MFM6
Name
(RefSeq) BAG cochaperone 3
  KO
K09557  BCL2-associated athanogene 3
Organism
hsa  Homo sapiens (human)
Disease
H00294  Dilated cardiomyopathy
H00595  Myofibrillar myopathies
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    9531 (BAG3)
   04131 Membrane trafficking [BR:hsa04131]
    9531 (BAG3)
Chaperones and folding catalysts [BR:hsa03110]
 Other chaperones and cochaperones
  BAG
   9531 (BAG3)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    9531 (BAG3)
SSDB
Motif
Pfam: BAG WW
Other DBs
NCBI-GeneID: 9531
NCBI-ProteinID: NP_004272
OMIM: 603883
HGNC: 939
Ensembl: ENSG00000151929
Pharos: O95817(Tbio)
UniProt: O95817
Position
10:119651380..119677819
AA seq 575 aa
MSAATHSPMMQVASGNGDRDPLPPGWEIKIDPQTGWPFFVDHNSRTTTWNDPRVPSEGPK
ETPSSANGPSREGSRLPPAREGHPVYPQLRPGYIPIPVLHEGAENRQVHPFHVYPQPGMQ
RFRTEAAAAAPQRSQSPLRGMPETTQPDKQCGQVAAAAAAQPPASHGPERSQSPAASDCS
SSSSSASLPSSGRSSLGSHQLPRGYISIPVIHEQNVTRPAAQPSFHQAQKTHYPAQQGEY
QTHQPVYHKIQGDDWEPRPLRAASPFRSSVQGASSREGSPARSSTPLHSPSPIRVHTVVD
RPQQPMTHRETAPVSQPENKPESKPGPVGPELPPGHIPIQVIRKEVDSKPVSQKPPPPSE
KVEVKVPPAPVPCPPPSPGPSAVPSSPKSVATEERAAPSTAPAEATPPKPGEAEAPPKHP
GVLKVEAILEKVQGLEQAVDNFEGKKTDKKYLMIEEYLTKELLALDSVDPEGRADVRQAR
RDGVRKVQTILEKLEQKAIDVPGQVQVYELQPSNLEADQPLQAIMEMGAVAADKGKKNAG
NAEDPHTETQQPEATAAATSNPSSMTDTPGNPAAP
NT seq 1728 nt   +upstreamnt  +downstreamnt
atgagcgccgccacccactcgcccatgatgcaggtggcgtccggcaacggtgaccgcgac
cctttgccccccggatgggagatcaagatcgacccgcagaccggctggcccttcttcgtg
gaccacaacagccgcaccactacgtggaacgacccgcgcgtgccctctgagggccccaag
gagactccatcctctgccaatggcccttcccgggagggctctaggctgccgcctgctagg
gaaggccaccctgtgtacccccagctccgaccaggctacattcccattcctgtgctccat
gaaggcgctgagaaccggcaggtgcaccctttccatgtctatccccagcctgggatgcag
cgattccgaactgaggcggcagcagcggctcctcagaggtcccagtcacctctgcggggc
atgccagaaaccactcagccagataaacagtgtggacaggtggcagcggcggcggcagcc
cagcccccagcctcccacggacctgagcggtcccagtctccagctgcctctgactgctca
tcctcatcctcctcggccagcctgccttcctccggcaggagcagcctgggcagtcaccag
ctcccgcgggggtacatctccattccggtgatacacgagcagaacgttacccggccagca
gcccagccctccttccaccaagcccagaagacgcactacccagcgcagcagggggagtac
cagacccaccagcctgtgtaccacaagatccagggggatgactgggagccccggcccctg
cgggcggcatccccgttcaggtcatctgtccagggtgcatcgagccgggagggctcacca
gccaggagcagcacgccactccactccccctcgcccatccgtgtgcacaccgtggtcgac
aggcctcagcagcccatgacccatcgagaaactgcacctgtttcccagcctgaaaacaaa
ccagaaagtaagccaggcccagttggaccagaactccctcctggacacatcccaattcaa
gtgatccgcaaagaggtggattctaaacctgtttcccagaagcccccacctccctctgag
aaggtagaggtgaaagttccccctgctccagttccttgtcctcctcccagccctggccct
tctgctgtcccctcttcccccaagagtgtggctacagaagagagggcagcccccagcact
gcccctgcagaagctacacctccaaaaccaggagaagccgaggctcccccaaaacatcca
ggagtgctgaaagtggaagccatcctggagaaggtacaggggctggagcaggctgtagac
aactttgaaggcaagaagactgacaaaaagtacctgatgatcgaagagtatttgaccaaa
gagctgctggccctggattcagtggaccccgagggacgagccgatgtgcgtcaggccagg
agagacggtgtcaggaaggttcagaccatcttggaaaaacttgaacagaaagccattgat
gtcccaggtcaagtccaggtctatgaactccagcccagcaaccttgaagcagatcagcca
ctgcaggcaatcatggagatgggtgccgtggcagcagacaagggcaagaaaaatgctgga
aatgcagaagatccccacacagaaacccagcagccagaagccacagcagcagcgacttca
aaccccagcagcatgacagacacccctggtaacccagcagcaccgtag

DBGET integrated database retrieval system