KEGG   Homo sapiens (human): 9669Help
Entry
9669              CDS       T01001                                 

Gene name
EIF5B, IF2
Definition
(RefSeq) eukaryotic translation initiation factor 5B
  KO
K03243  translation initiation factor 5B
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    9669 (EIF5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hsa03012]
    9669 (EIF5B)
Translation factors [BR:hsa03012]
 Eukaryotic type
  Initiation factors
   eIF-5
    9669 (EIF5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU IF-2 GTP_EFTU_D4 GTP_EFTU_D2 MMR_HSR1 Roc ATP_bind_1
Motif
Other DBs
NCBI-GeneID: 9669
NCBI-ProteinID: NP_056988
OMIM: 606086
HGNC: 30793
Ensembl: ENSG00000158417
Vega: OTTHUMG00000153242
Pharos: O60841(Tbio)
UniProt: O60841 Q8N5A0
Position
2q11.2
AA seq 1220 aa AA seqDB search
MGKKQKNKSEDSTKDDIDLDALAAEIEGAGAAKEQEPQKSKGKKKKEKKKQDFDEDDILK
ELEELSLEAQGIKADRETVAVKPTENNEEEFTSKDKKKKGQKGKKQSFDDNDSEELEDKD
SKSKKTAKPKVEMYSGSDDDDDFNKLPKKAKGKAQKSNKKWDGSEEDEDNSKKIKERSRI
NSSGESGDESDEFLQSRKGQKKNQKNKPGPNIESGNEDDDASFKIKTVAQKKAEKKERER
KKRDEEKAKLRKLKEKEELETGKKDQSKQKESQRKFEEETVKSKVTVDTGVIPASEEKAE
TPTAAEDDNEGDKKKKDKKKKKGEKEEKEKEKKKGPSKATVKAMQEALAKLKEEEERQKR
EEEERIKRLEELEAKRKEEERLEQEKRERKKQKEKERKERLKKEGKLLTKSQREARARAE
ATLKLLQAQGVEVPSKDSLPKKRPIYEDKKRKKIPQQLESKEVSESMELCAAVEVMEQGV
PEKEETPPPVEPEEEEDTEDAGLDDWEAMASDEETEKVEGNKVHIEVKENPEEEEEEEEE
EEEDEESEEEEEEEGESEGSEGDEEDEKVSDEKDSGKTLDKKPSKEMSSDSEYDSDDDRT
KEERAYDKAKRRIEKRRLEHSKNVNTEKLRAPIICVLGHVDTGKTKILDKLRHTHVQDGE
AGGITQQIGATNVPLEAINEQTKMIKNFDRENVRIPGMLIIDTPGHESFSNLRNRGSSLC
DIAILVVDIMHGLEPQTIESINLLKSKKCPFIVALNKIDRLYDWKKSPDSDVAATLKKQK
KNTKDEFEERAKAIIVEFAQQGLNAALFYENKDPRTFVSLVPTSAHTGDGMGSLIYLLVE
LTQTMLSKRLAHCEELRAQVMEVKALPGMGTTIDVILINGRLKEGDTIIVPGVEGPIVTQ
IRGLLLPPPMKELRVKNQYEKHKEVEAAQGVKILGKDLEKTLAGLPLLVAYKEDEIPVLK
DELIHELKQTLNAIKLEEKGVYVQASTLGSLEALLEFLKTSEVPYAGINIGPVHKKDVMK
ASVMLEHDPQYAVILAFDVRIERDAQEMADSLGVRIFSAEIIYHLFDAFTKYRQDYKKQK
QEEFKHIAVFPCKIKILPQYIFNSRDPIVMGVTVEAGQVKQGTPMCVPSKNFVDIGIVTS
IEINHKQVDVAKKGQEVCVKIEPIPGESPKMFGRHFEATDILVSKISRQSIDALKDWFRD
EMQKSDWQLIVELKKVFEII
NT seq 3663 nt NT seq  +upstreamnt  +downstreamnt
atggggaagaaacagaaaaacaagagcgaagacagcaccaaggatgacattgatcttgat
gccttggctgcagaaatagaaggagctggtgctgccaaagaacaggagcctcaaaagtca
aaagggaaaaagaaaaaagagaaaaaaaagcaggactttgatgaagatgatatcctgaaa
gaactggaagaattgtctttggaagctcaaggcatcaaagctgacagagaaactgttgca
gtgaagccaacagaaaacaatgaagaggaattcacctcaaaagataaaaaaaagaaagga
cagaagggcaaaaaacagagttttgatgataatgatagcgaagaattggaagataaagat
tcaaaatcaaaaaagactgcaaaaccgaaagtggaaatgtactctgggagtgatgatgat
gatgattttaacaaacttcctaaaaaagctaaagggaaagctcaaaaatcaaataagaag
tgggatgggtcagaggaggatgaggataacagtaaaaaaattaaagagcgttcaagaata
aattcttctggtgaaagtggtgatgaatcagatgaatttttgcaatctagaaaaggacag
aaaaaaaatcagaaaaacaagccaggtcctaacatagaaagtgggaatgaagatgatgac
gcctccttcaaaattaagacagtggcccaaaagaaggcagaaaagaaggagcgcgagaga
aaaaagcgagatgaagaaaaagcgaaactgcggaagctgaaagaaaaagaagagttagaa
acaggtaaaaaggatcagagtaaacaaaaggaatctcaaaggaaatttgaagaagaaact
gtaaaatccaaagtgactgttgatactggagtaattcctgcctctgaagagaaagcagag
actcccacagctgcagaagatgacaatgaaggagacaaaaagaagaaagataagaagaaa
aagaaaggagaaaaggaagaaaaagagaaagagaagaaaaaaggacctagcaaagccact
gttaaagctatgcaagaagctctggctaagcttaaagaggaagaagaaagacagaagaga
gaagaggaagaacgtataaaacggcttgaagaattagaagccaagcgtaaagaagaggaa
cgattggaacaagaaaaaagagaaaggaaaaagcaaaaagaaaaagaaagaaaagaacgc
ttgaaaaaagaagggaaacttttaactaaatcccagagagaagccagagccagagccgaa
gctactcttaaactgctacaagctcagggtgttgaagtgccatcaaaagactctttgcca
aagaagaggccaatttatgaagataaaaagaggaaaaaaataccacagcagctagaaagt
aaagaagtgtctgaatcaatggaattatgtgctgctgtagaagttatggaacaaggagta
ccagaaaaggaagagacaccacctcctgttgaaccagaagaagaagaagatactgaggat
gctggattggatgattgggaagctatggccagtgatgaggagacagaaaaagtagaagga
aacaaagttcatatagaagtaaaagaaaaccctgaagaggaggaggaggaggaagaagag
gaagaagaagatgaagaaagtgaagaagaggaggaagaggagggagaaagtgaaggcagt
gaaggtgatgaggaagatgaaaaggtgtcagatgagaaggattcagggaagacattagat
aaaaagccaagtaaagaaatgagctcagattctgaatatgactctgatgatgatcggact
aaagaagaaagggcttatgacaaagcaaaacggaggattgagaaacggcgacttgaacat
agtaaaaatgtaaacaccgaaaagctaagagcccctattatctgcgtacttgggcatgtg
gacacagggaagacaaaaattctagataagctccgtcacacacatgtacaagatggtgaa
gcaggtggtatcacacaacaaattggggccaccaatgttcctcttgaagctattaatgaa
cagactaagatgattaaaaattttgatagagagaatgtacggattccaggaatgctaatt
attgatactcctgggcatgaatctttcagtaatctgagaaatagaggaagctctctttgt
gacattgccattttagttgttgatattatgcatggtttggagccccagacaattgagtct
atcaaccttctcaaatctaaaaaatgtcccttcattgttgcactcaataagattgatagg
ttatatgattggaaaaagagtcctgactctgatgtggctgctactttaaagaagcagaaa
aagaatacaaaagatgaatttgaggagcgagcaaaggctattattgtagaatttgcacag
cagggtttgaatgctgctttgttttatgagaataaagatccccgcacttttgtgtctttg
gtacctacctctgcacatactggtgatggcatgggaagtctgatctaccttcttgtagag
ttaactcagaccatgttgagcaagagacttgcacactgtgaagagctgagagcacaggtg
atggaggttaaagctctcccggggatgggcaccactatagatgtcatcttgatcaatggg
cgtttgaaggaaggagatacaatcattgttcctggagtagaagggcccattgtaactcag
attcgaggcctcctgttacctcctcctatgaaggaattacgagtgaagaaccagtatgaa
aagcataaagaagtagaagcagctcagggggtaaagattcttggaaaagacctggagaaa
acattggctggtttacccctccttgtggcttataaagaagatgaaatccctgttcttaaa
gatgaattgatccatgagttaaagcagacactaaatgctatcaaattagaagaaaaagga
gtctatgtccaggcatctacactgggttctttggaagctctactggaatttctgaaaaca
tcagaagtgccctatgcaggaattaacattggcccagtgcataaaaaagatgttatgaag
gcttcagtgatgttggaacatgaccctcagtatgcagtaattttggccttcgatgtgaga
attgaacgagatgcacaagaaatggctgatagtttaggagttagaatttttagtgcagaa
attatttatcatttatttgatgcctttacaaaatatagacaagactacaagaaacagaaa
caagaagaatttaagcacatagcagtatttccctgcaagataaaaatcctccctcagtac
atttttaattctcgagatccgatagtgatgggggtgacggtggaagcaggtcaggtgaaa
caggggacacccatgtgtgtcccaagcaaaaattttgttgacatcggaatagtaacaagt
attgaaataaaccataaacaagtggatgttgcaaaaaaaggacaagaagtttgtgtaaaa
atagaacctatccctggtgagtcacccaaaatgtttggaagacattttgaagctacagat
attcttgttagtaagatcagccggcagtccattgatgcactcaaagactggttcagagat
gaaatgcagaagagtgactggcagcttattgtggagctgaagaaagtatttgaaatcatc
taa

DBGET integrated database retrieval system