KEGG   Homo sapiens (human): 969
Entry
969               CDS       T01001                                 
Symbol
CD69, AIM, BL-AC/P26, CLEC2C, EA1, GP32/28, MLR-3
Name
(RefSeq) CD69 molecule
  KO
K06502  CD69 antigen
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    969 (CD69)
   04091 Lectins [BR:hsa04091]
    969 (CD69)
CD molecules [BR:hsa04090]
 Proteins
  969 (CD69)
Lectins [BR:hsa04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   969 (CD69)
SSDB
Motif
Pfam: Lectin_C UL45 Agarase_CBM
Other DBs
NCBI-GeneID: 969
NCBI-ProteinID: NP_001772
OMIM: 107273
HGNC: 1694
Ensembl: ENSG00000110848
Pharos: Q07108(Tbio)
UniProt: Q07108 Q53ZX0
Structure
Position
12:complement(9752486..9760901)
AA seq 199 aa
MSSENCFVAENSSLHPESGQENDATSPHFSTRHEGSFQVPVLCAVMNVVFITILIIALIA
LSVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATL
AVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTE
VSSMECEKNLYWICNKPYK
NT seq 600 nt   +upstreamnt  +downstreamnt
atgagctctgaaaattgtttcgtagcagagaacagctctttgcatccggagagtggacaa
gaaaatgatgccaccagtccccatttctcaacacgtcatgaagggtccttccaagttcct
gtcctgtgtgctgtaatgaatgtggtcttcatcaccattttaatcatagctctcattgcc
ttatcagtgggccaatacaattgtccaggccaatacacattctcaatgccatcagacagc
catgtttcttcatgctctgaggactgggttggctaccagaggaaatgctactttatttct
actgtgaagaggagctggacttcagcccaaaatgcttgttctgaacatggtgctactctt
gctgtcattgattctgaaaaggacatgaactttctaaaacgatacgcaggtagagaggaa
cactgggttggactgaaaaaggaacctggtcacccatggaagtggtcaaatggcaaagaa
tttaacaactggttcaacgttacagggtctgacaagtgtgtttttctgaaaaacacagag
gtcagcagcatggaatgtgagaagaatttatactggatatgtaacaaaccttacaaataa

DBGET integrated database retrieval system