KEGG   Homo sapiens (human): 9708
Entry
9708              CDS       T01001                                 

Gene name
PCDHGA8, PCDH-GAMMA-A8
Definition
(RefSeq) protocadherin gamma subfamily A, 8
  KO
K16495  protocadherin gamma subfamily A
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    9708 (PCDHGA8)
Cell adhesion molecules [BR:hsa04515]
 Cadherins
  Protocadherins
   9708 (PCDHGA8)
SSDB
Motif
Pfam: Cadherin Cadherin_2 Cadherin_tail Cadherin_C_2 RET_CLD1 Cadherin_3
Other DBs
NCBI-GeneID: 9708
NCBI-ProteinID: NP_114477
OMIM: 606295
HGNC: 8706
Ensembl: ENSG00000253767
Vega: OTTHUMG00000164053
Pharos: Q9Y5G5(Tdark)
UniProt: Q9Y5G5
Position
5q31.3
AA seq 932 aa
MAAPQSRPRRGELILLCALLGTLWEIGRGQIRYSVPEETDKGSFVGNISKDLGLDPRKLA
KHGVRIVSRGRTQLFALNPRSGSLITAGRIDREELCAQSPRCLININTLVEDKGKLFGVE
IEIIDINDNNPKFQVEDLEVKINEIAVPGARYPLPEAVDPDVGVNSLQSYQLSPNHHFSL
DVQTGDNGAINPELVLERALDREEEAAHHLVLTASDGGKPPRSSTVRIHVTVLDTNDNAP
VFPHPIYRVKVLENMPPGTRLLTVTASDPDEGINGKVAYKFRKINEKQTPLFQLNENTGE
ISIAKSLDYEECSFYEMEIQAEDVGALLGRTKLLISVEDVNDNRPEVIITSLFSPVLENS
LPGTVIAFLSVHDQDSGKNGQVVCYTRDNLPFKLEKSIGNYYRLVTRKYLDRENVSIYNI
TVMASDLGTPPLSTETQIALHVADINDNPPTFPHASYSAYILENNLRGASIFSLTAHDPD
SQENAQVTYSVTEDTLQGAPLSSYISINSDTGVLYALQSFDYEQIRDLQLLVTASDSGDP
PLSSNMSLSLFVLDQNDNAPEILYPALPTDGSTGVELAPRSAERGYLVTKVVAVDRDSGQ
NAWLSYRLLKASEPGLFSVGLHTGEVRTARALLDRDALKQSLVVAVQDHGQPPLSATVTL
TVAVADSIPEVLTELGSLKPSVDPNDSSLTLYLVVAVAAISCVFLAFVAVLLGLRLRRWH
KSRLLQDSGGRLVGVPASHFVGVEEVQAFLQTYSQEVSLTADSRKSHLIFPQPNYADMLI
SQEGCEKNDSLLTSVDFHEYKNEADHGQQAPPNTDWRFSQAQRPGTSGSQNGDDTGTWPN
NQFDTEMLQAMILASASEAADGSSTLGGGAGTMGLSARYGPQFTLQHVPDYRQNVYIPGS
NATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK
NT seq 2799 nt   +upstreamnt  +downstreamnt
atggccgctccacagagtcgccccagacgcggcgagctgatcctgctgtgcgcgctgctg
ggaacgctgtgggaaatcgggaggggacagattcgctactctgtgccagaagagacggac
aaaggctccttcgtgggtaatatctccaaggacctggggctggacccccggaagctggcg
aagcacggagtccgtatcgtctccagaggtaggacgcagctctttgctctgaacccgcgc
agcggcagcttgatcaccgcgggcaggatagatcgggaggagctctgcgctcagagcccg
cggtgtctgataaatattaacaccctggttgaggataaaggaaaactctttggggtagaa
atagaaataattgatattaacgataataacccaaaattccaggtcgaagatctagaagta
aaaattaacgaaatcgcggttcctggagcacgttatccactcccagaagctgttgacccg
gatgtgggcgtgaactccctccagagctaccagctcagccccaatcaccacttctccctg
gacgtgcagactggagacaatggagccataaacccagagctggtgctggagcgcgccctg
gacagggaggaagaggctgctcaccacctggtcctcacggcctcggatggcggcaagccg
cctcgctctagcacagtgcgcatccacgtgacagtgttggatacaaatgacaatgccccg
gtttttcctcacccgatttaccgagtgaaagtccttgagaacatgcccccaggcacgcgg
ctgcttactgtaacagccagcgacccggatgagggaatcaacggaaaagtggcatacaaa
ttccggaaaattaatgaaaaacaaactccgttattccagcttaatgaaaatactggggaa
atatcaatagcaaaaagtctagattatgaagaatgttcattttatgaaatggaaatacaa
gccgaagatgtgggggcacttctggggaggaccaaattgctcatttcggtggaagatgta
aatgacaatagaccagaagtgatcattacgtctttgtttagcccagtgttagaaaattct
cttcccgggacagtaattgccttcttgagtgtgcatgaccaagactctggaaagaatggt
caagttgtctgttacacacgtgataatttaccttttaaattagaaaagtcaataggtaat
tattatagattagtgacaaggaaatatttggaccgagaaaatgtctctatctacaatatc
acagtgatggcctcagatctaggaacaccacctctgtccactgaaactcaaatcgctctg
cacgtggcagacattaacgacaaccctcctactttccctcatgcctcctactcagcgtat
atcctagagaacaacctgagaggagcctccatcttttccttgactgcacacgaccccgac
agccaggagaatgcccaggtcacttactctgtgaccgaggacacgctgcagggggcgccc
ctgtcctcgtatatctccatcaactctgacaccggtgtcctgtatgcgctgcaatctttc
gactatgagcagatccgagacctgcagctactggtaacagccagcgacagcggggacccg
cccctcagcagcaacatgtcactgagcctgttcgtgctggaccagaatgacaacgcgccc
gagatcctgtaccccgccctccccacagacggttccactggcgtggagctggcgccccgc
tccgcagagcgtggctacctggtgaccaaggtggtggcggtggacagagactcgggccag
aacgcctggctgtcctaccgcctgctcaaggccagcgagccgggactcttctcggtgggt
ctgcacacgggcgaggtgcgcacggcgcgagccctgctggacagagatgcgctcaagcag
agcctcgtggtggccgtccaggaccatggccagccccctctctccgccactgtcacgctc
accgtagccgtggctgacagcatccccgaagtcctgaccgagttgggcagtctgaagcct
tcggtcgacccgaacgattcgagccttacactctatctcgtggtggcagtggctgccatc
tcctgtgtcttcctcgcctttgtcgctgtgcttctggggctcaggctgaggcgctggcac
aagtcacgcctgctccaggattccggtggcagattggtaggcgtgcctgcctcacatttt
gtgggtgttgaggaggtacaggctttcctgcagacctattcccaggaagtctccctcacc
gccgactcgcggaagagtcacctgatctttccccagcccaactacgcagacatgctcatc
agtcaggagggctgtgagaaaaatgattctttgttaacatccgtagattttcatgaatat
aagaatgaagctgatcatggtcagcaagccccgcccaacacggactggcgtttctctcag
gcccagagacccggcaccagcggctcccaaaatggcgatgacaccggcacctggcccaac
aaccagtttgacacagagatgctgcaagccatgatcttggcgtccgccagtgaagctgct
gatgggagctccaccctgggagggggtgccggcaccatgggattgagcgcccgctacgga
ccccagttcaccctgcagcacgtgcccgactaccgccagaatgtctacatcccaggcagc
aatgccacactgaccaacgcagctggcaagcgggatggcaaggccccagcaggtggcaat
ggcaacaagaagaagtcgggcaagaaggagaagaagtaa

DBGET integrated database retrieval system