KEGG   Homo sapiens (human): 9334Help
Entry
9334              CDS       T01001                                 

Gene name
B4GALT5, B4Gal-T5, BETA4-GALT-IV, beta4Gal-T5, beta4GalT-V, gt-V
Definition
(RefSeq) beta-1,4-galactosyltransferase 5
  KO
K09905  beta-1,4-galactosyltransferase 5 [EC:2.4.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00512  Mucin type O-glycan biosynthesis
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    9334 (B4GALT5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     9334 (B4GALT5)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   9334 (B4GALT5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_7N Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 9334
NCBI-ProteinID: NP_004767
OMIM: 604016
HGNC: 928
Ensembl: ENSG00000158470
Vega: OTTHUMG00000033086
Pharos: O43286(Tbio)
UniProt: O43286
Position
20q13.13
AA seq 388 aa AA seqDB search
MRARRGLLRLPRRSLLAALFFFSLSSSLLYFVYVAPGIVNTYLFMMQAQGILIRDNVRTI
GAQVYEQVLRSAYAKRNSSVNDSDYPLDLNHSETFLQTTTFLPEDFTYFANHTCPERLPS
MKGPIDINMSEIGMDYIHELFSKDPTIKLGGHWKPSDCMPRWKVAILIPFRNRHEHLPVL
FRHLLPMLQRQRLQFAFYVVEQVGTQPFNRAMLFNVGFQEAMKDLDWDCLIFHDVDHIPE
SDRNYYGCGQMPRHFATKLDKYMYLLPYTEFFGGVSGLTVEQFRKINGFPNAFWGWGGED
DDLWNRVQNAGYSVSRPEGDTGKYKSIPHHHRGEVQFLGRYALLRKSKERQGLDGLNNLN
YFANITYDALYKNITVNLTPELAQVNEY
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcccgccgggggctgctgcggctgccgcgccgctcgctgctcgccgcgctcttc
ttcttttctctctcgtcctcgctgctgtacttcgtctatgtggcgcccggcatagtgaac
acctacctcttcatgatgcaagcccaaggcattctgatccgggacaacgtgagaacaatc
ggtgctcaggtttatgagcaggtgcttcggagtgcttatgccaagaggaacagcagtgta
aatgactcagattatcctcttgacttgaaccacagtgaaaccttcctgcaaactacaaca
tttcttcctgaagacttcacctactttgcaaaccatacctgccctgaaagactcccttcc
atgaagggcccaatagacataaacatgagtgaaattggaatggattacattcatgaactc
ttctccaaagacccaaccatcaagctcggaggtcactggaagccttctgattgcatgcct
cggtggaaggtggcgatccttatccccttccggaaccgccacgagcacctcccagtcctg
ttcagacacctgcttcccatgctccagcgccagcgcttgcagtttgcattttatgtggtt
gaacaagttggtacccaaccctttaatcgagccatgcttttcaacgttggctttcaagag
gcaatgaaagacttggattgggactgtttgatttttcatgatgtagatcacataccggaa
agtgatcgcaactattatggatgtggacagatgccgaggcattttgcaaccaaattggat
aagtatatgtatctgcttccttataccgagttctttggcggagtgagtggcttaacagtg
gaacaatttcggaaaatcaatggctttcctaatgctttctggggttggggtggagaagat
gacgacctctggaacagagtacagaatgcaggctattctgtgagccggccagagggtgac
acaggaaagtacaagtccattcctcatcaccatcgaggagaagtccagtttcttggaagg
tatgctctgctgaggaagtcaaaagaacggcaagggctggatggcctcaacaacctgaac
tactttgcaaacatcacatacgacgccttgtataaaaacataactgtcaacctgacaccc
gagctggctcaggtgaacgagtactga

DBGET integrated database retrieval system