KEGG   Homo sapiens (human): 100Help
Entry
100               CDS       T01001                                 

Gene name
ADA
Definition
(RefSeq) adenosine deaminase
  KO
K01488  adenosine deaminase [EC:3.5.4.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa05340  Primary immunodeficiency
Disease
H00092  T-B-Severe combined immunodeficiencies (SCIDs)
Drug target
Pentostatin: D00155
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100 (ADA)
 09160 Human Diseases
  09162 Immune diseases
   05340 Primary immunodeficiency
    100 (ADA)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.4  adenosine deaminase
     100 (ADA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: A_deaminase
Motif
Other DBs
NCBI-GeneID: 100
NCBI-ProteinID: NP_000013
OMIM: 608958
HGNC: 186
Ensembl: ENSG00000196839
Vega: OTTHUMG00000033081
Pharos: P00813(Tclin)
UniProt: P00813 A0A0S2Z381
Structure
PDB: 

Position
20q13.12
AA seq 363 aa AA seqDB search
MAQTPAFDKPKVELHVHLDGSIKPETILYYGRRRGIALPANTAEGLLNVIGMDKPLTLPD
FLAKFDYYMPAIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVEPIPWNQA
EGDLTPDEVVALVGQGLQEGERDFGVKARSILCCMRHQPNWSPKVVELCKKYQQQTVVAI
DLAGDETIPGSSLLPGHVQAYQEAVKSGIHRTVHAGEVGSAEVVKEAVDILKTERLGHGY
HTLEDQALYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRLKNDQANYSLNTDDPLIF
KSTLDTDYQMTKRDMGFTEEEFKRLNINAAKSSFLPEDEKRELLDLLYKAYGMPPSASAG
QNL
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcccagacgcccgccttcgacaagcccaaagtagaactgcatgtccacctagacgga
tccatcaagcctgaaaccatcttatactatggcaggaggagagggatcgccctcccagct
aacacagcagaggggctgctgaacgtcattggcatggacaagccgctcacccttccagac
ttcctggccaagtttgactactacatgcctgctatcgcgggctgccgggaggctatcaaa
aggatcgcctatgagtttgtagagatgaaggccaaagagggcgtggtgtatgtggaggtg
cggtacagtccgcacctgctggccaactccaaagtggagccaatcccctggaaccaggct
gaaggggacctcaccccagacgaggtggtggccctagtgggccagggcctgcaggagggg
gagcgagacttcggggtcaaggcccggtccatcctgtgctgcatgcgccaccagcccaac
tggtcccccaaggtggtggagctgtgtaagaagtaccagcagcagaccgtggtagccatt
gacctggctggagatgagaccatcccaggaagcagcctcttgcctggacatgtccaggcc
taccaggaggctgtgaagagcggcattcaccgtactgtccacgccggggaggtgggctcg
gccgaagtagtaaaagaggctgtggacatactcaagacagagcggctgggacacggctac
cacaccctggaagaccaggccctttataacaggctgcggcaggaaaacatgcacttcgag
atctgcccctggtccagctacctcactggtgcctggaagccggacacggagcatgcagtc
attcggctcaaaaatgaccaggctaactactcgctcaacacagatgacccgctcatcttc
aagtccaccctggacactgattaccagatgaccaaacgggacatgggctttactgaagag
gagtttaaaaggctgaacatcaatgcggccaaatctagtttcctcccagaagatgaaaag
agggagcttctcgacctgctctataaagcctatgggatgccaccttcagcctctgcaggg
cagaacctctga

DBGET integrated database retrieval system