KEGG   Homo sapiens (human): 1000Help
Entry
1000              CDS       T01001                                 

Gene name
CDH2, CD325, CDHN, CDw325, NCAD
Definition
(RefSeq) cadherin 2
  KO
K06736  cadherin 2, type 1, N-cadherin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    1000 (CDH2)
 09160 Human Diseases
  09166 Cardiovascular diseases
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    1000 (CDH2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    1000 (CDH2)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    1000 (CDH2)
   04090 CD molecules [BR:hsa04090]
    1000 (CDH2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    1000 (CDH2)
Cell adhesion molecules [BR:hsa04515]
 Cadherins
  Major cadherins
   1000 (CDH2)
CD molecules [BR:hsa04090]
 Proteins
  1000 (CDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin Cadherin_C Cadherin_pro Cadherin_3 He_PIG EphA2_TM DUF5385 DUF4381 Stevor
Motif
Other DBs
NCBI-GeneID: 1000
NCBI-ProteinID: NP_001783
OMIM: 114020
HGNC: 1759
Ensembl: ENSG00000170558
Vega: OTTHUMG00000059940
Pharos: P19022(Tbio)
UniProt: P19022 A0A024RC42
Position
18q12.1
AA seq 906 aa AA seqDB search
MCRIAGALRTLLPLLAALLQASVEASGEIALCKTGFPEDVYSAVLSKDVHEGQPLLNVKF
SNCNGKRKVQYESSEPADFKVDEDGMVYAVRSFPLSSEHAKFLIYAQDKETQEKWQVAVK
LSLKPTLTEESVKESAEVEEIVFPRQFSKHSGHLQRQKRDWVIPPINLPENSRGPFPQEL
VRIRSDRDKNLSLRYSVTGPGADQPPTGIFIINPISGQLSVTKPLDREQIARFHLRAHAV
DINGNQVENPIDIVINVIDMNDNRPEFLHQVWNGTVPEGSKPGTYVMTVTAIDADDPNAL
NGMLRYRIVSQAPSTPSPNMFTINNETGDIITVAAGLDREKVQQYTLIIQATDMEGNPTY
GLSNTATAVITVTDVNDNPPEFTAMTFYGEVPENRVDIIVANLTVTDKDQPHTPAWNAVY
RISGGDPTGRFAIQTDPNSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQS
TATVSVTVIDVNENPYFAPNPKIIRQEEGLHAGTMLTTFTAQDPDRYMQQNIRYTKLSDP
ANWLKIDPVNGQITTIAVLDRESPNVKNNIYNATFLASDNGIPPMSGTGTLQIYLLDIND
NAPQVLPQEAETCETPDPNSINITALDYDIDPNAGPFAFDLPLSPVTIKRNWTITRLNGD
FAQLNLKIKFLEAGIYEVPIIITDSGNPPKSNISILRVKVCQCDSNGDCTDVDRIVGAGL
GTGAIIAILLCIIILLILVLMFVVWMKRRDKERQAKQLLIDPEDDVRDNILKYDEEGGGE
EDQDYDLSQLQQPDTVEPDAIKPVGIRRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGL
KAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADM
YGGGDD
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atgtgccggatagcgggagcgctgcggaccctgctgccgctgctggcggccctgcttcag
gcgtctgtagaggcttctggtgaaatcgcattatgcaagactggatttcctgaagatgtt
tacagtgcagtcttatcgaaggatgtgcatgaaggacagcctcttctcaatgtgaagttt
agcaactgcaatggaaaaagaaaagtacaatatgagagcagtgagcctgcagattttaag
gtggatgaagatggcatggtgtatgccgtgagaagctttccactctcttctgagcatgcc
aagttcctgatatatgcccaagacaaagagacccaggaaaagtggcaagtggcagtaaaa
ttgagcctgaagccaaccttaactgaggagtcagtgaaggagtcagcagaagttgaagaa
atagtgttcccaagacaattcagtaagcacagtggccacctacaaaggcagaagagagac
tgggtcatccctccaatcaacttgccagaaaactccaggggaccttttcctcaagagctt
gtcaggatcaggtctgatagagataaaaacctttcactgcggtacagtgtaactgggcca
ggagctgaccagcctccaactggtatcttcattatcaaccccatctcgggtcagctgtcg
gtgacaaagcccctggatcgcgagcagatagcccggtttcatttgagggcacatgcagta
gatattaatggaaatcaagtggagaaccccattgacattgtcatcaatgttattgacatg
aatgacaacagacctgagttcttacaccaggtttggaatgggacagttcctgagggatca
aagcctggaacatatgtgatgaccgtaacagcaattgatgctgacgatcccaatgccctc
aatgggatgttgaggtacagaatcgtgtctcaggctccaagcaccccttcacccaacatg
tttacaatcaacaatgagactggtgacatcatcacagtggcagctggacttgatcgagaa
aaagtgcaacagtatacgttaataattcaagctacagacatggaaggcaatcccacatat
ggcctttcaaacacagccacggccgtcatcacagtgacagatgtcaatgacaatcctcca
gagtttactgccatgacgttttatggtgaagttcctgagaacagggtagacatcatagta
gctaatctaactgtgaccgataaggatcaaccccatacaccagcctggaacgcagtgtac
agaatcagtggcggagatcctactggacggttcgccatccagaccgacccaaacagcaac
gacgggttagtcaccgtggtcaaaccaatcgactttgaaacaaataggatgtttgtcctt
actgttgctgcagaaaatcaagtgccattagccaagggaattcagcacccgcctcagtca
actgcaaccgtgtctgttacagttattgacgtaaatgaaaacccttattttgcccccaat
cctaagatcattcgccaagaagaagggcttcatgccggtaccatgttgacaacattcact
gctcaggacccagatcgatatatgcagcaaaatattagatacactaaattatctgatcct
gccaattggctaaaaatagatcctgtgaatggacaaataactacaattgctgttttggac
cgagaatcaccaaatgtgaaaaacaatatatataatgctactttccttgcttctgacaat
ggaattcctcctatgagtggaacaggaacgctgcagatctatttacttgatattaatgac
aatgcccctcaagtgttacctcaagaggcagagacttgcgaaactccagaccccaattca
attaatattacagcacttgattatgacattgatccaaatgctggaccatttgcttttgat
cttcctttatctccagtgactattaagagaaattggaccatcactcggcttaatggtgat
tttgctcagcttaatttaaagataaaatttcttgaagctggtatctatgaagttcccatc
ataatcacagattcgggtaatcctcccaaatcaaatatttccatcctgcgcgtgaaggtt
tgccagtgtgactccaacggggactgcacagatgtggacaggattgtgggtgcggggctt
ggcaccggtgccatcattgccatcctgctctgcatcatcatcctgcttatccttgtgctg
atgtttgtggtatggatgaaacgccgggataaagaacgccaggccaaacaacttttaatt
gatccagaagatgatgtaagagataatattttaaaatatgatgaagaaggtggaggagaa
gaagaccaggactatgacttgagccagctgcagcagcctgacactgtggagcctgatgcc
atcaagcctgtgggaatccgacgaatggatgaaagacccatccacgccgagccccagtat
ccggtccgatctgcagccccacaccctggagacattggggacttcattaatgagggcctt
aaagcggctgacaatgaccccacagctccaccatatgactccctgttagtgtttgactat
gaaggcagtggctccactgctgggtccttgagctcccttaattcctcaagtagtggtggt
gagcaggactatgattacctgaacgactgggggccacggttcaagaaacttgctgacatg
tatggtggaggtgatgactga

DBGET integrated database retrieval system