KEGG   Homo sapiens (human): 1000Help
Entry
1000              CDS       T01001                                 

Gene name
CDH2, CD325, CDHN, CDw325, NCAD
Definition
(RefSeq) cadherin 2
  KO
K06736  cadherin 2, type 1, N-cadherin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    1000 (CDH2)
 Human Diseases
  Cardiovascular diseases
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    1000 (CDH2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    1000 (CDH2)
Cell adhesion molecules [BR:hsa04515]
 Cadherins
  Major cadherins
   1000 (CDH2)
CD molecules [BR:hsa04090]
 Proteins
  1000 (CDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin Cadherin_C Cadherin_pro Cadherin_3 He_PIG EphA2_TM DUF5385 DUF4381 Stevor
Motif
Other DBs
NCBI-GeneID: 1000
NCBI-ProteinID: NP_001783
OMIM: 114020
HGNC: 1759
Ensembl: ENSG00000170558
Vega: OTTHUMG00000059940
Pharos: P19022(Tbio)
UniProt: P19022 A0A024RC42
Position
18q12.1
AA seq 906 aa AA seqDB search
MCRIAGALRTLLPLLAALLQASVEASGEIALCKTGFPEDVYSAVLSKDVHEGQPLLNVKF
SNCNGKRKVQYESSEPADFKVDEDGMVYAVRSFPLSSEHAKFLIYAQDKETQEKWQVAVK
LSLKPTLTEESVKESAEVEEIVFPRQFSKHSGHLQRQKRDWVIPPINLPENSRGPFPQEL
VRIRSDRDKNLSLRYSVTGPGADQPPTGIFIINPISGQLSVTKPLDREQIARFHLRAHAV
DINGNQVENPIDIVINVIDMNDNRPEFLHQVWNGTVPEGSKPGTYVMTVTAIDADDPNAL
NGMLRYRIVSQAPSTPSPNMFTINNETGDIITVAAGLDREKVQQYTLIIQATDMEGNPTY
GLSNTATAVITVTDVNDNPPEFTAMTFYGEVPENRVDIIVANLTVTDKDQPHTPAWNAVY
RISGGDPTGRFAIQTDPNSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQS
TATVSVTVIDVNENPYFAPNPKIIRQEEGLHAGTMLTTFTAQDPDRYMQQNIRYTKLSDP
ANWLKIDPVNGQITTIAVLDRESPNVKNNIYNATFLASDNGIPPMSGTGTLQIYLLDIND
NAPQVLPQEAETCETPDPNSINITALDYDIDPNAGPFAFDLPLSPVTIKRNWTITRLNGD
FAQLNLKIKFLEAGIYEVPIIITDSGNPPKSNISILRVKVCQCDSNGDCTDVDRIVGAGL
GTGAIIAILLCIIILLILVLMFVVWMKRRDKERQAKQLLIDPEDDVRDNILKYDEEGGGE
EDQDYDLSQLQQPDTVEPDAIKPVGIRRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGL
KAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADM
YGGGDD
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atgtgccggatagcgggagcgctgcggaccctgctgccgctgctggcggccctgcttcag
gcgtctgtagaggcttctggtgaaatcgcattatgcaagactggatttcctgaagatgtt
tacagtgcagtcttatcgaaggatgtgcatgaaggacagcctcttctcaatgtgaagttt
agcaactgcaatggaaaaagaaaagtacaatatgagagcagtgagcctgcagattttaag
gtggatgaagatggcatggtgtatgccgtgagaagctttccactctcttctgagcatgcc
aagttcctgatatatgcccaagacaaagagacccaggaaaagtggcaagtggcagtaaaa
ttgagcctgaagccaaccttaactgaggagtcagtgaaggagtcagcagaagttgaagaa
atagtgttcccaagacaattcagtaagcacagtggccacctacaaaggcagaagagagac
tgggtcatccctccaatcaacttgccagaaaactccaggggaccttttcctcaagagctt
gtcaggatcaggtctgatagagataaaaacctttcactgcggtacagtgtaactgggcca
ggagctgaccagcctccaactggtatcttcattatcaaccccatctcgggtcagctgtcg
gtgacaaagcccctggatcgcgagcagatagcccggtttcatttgagggcacatgcagta
gatattaatggaaatcaagtggagaaccccattgacattgtcatcaatgttattgacatg
aatgacaacagacctgagttcttacaccaggtttggaatgggacagttcctgagggatca
aagcctggaacatatgtgatgaccgtaacagcaattgatgctgacgatcccaatgccctc
aatgggatgttgaggtacagaatcgtgtctcaggctccaagcaccccttcacccaacatg
tttacaatcaacaatgagactggtgacatcatcacagtggcagctggacttgatcgagaa
aaagtgcaacagtatacgttaataattcaagctacagacatggaaggcaatcccacatat
ggcctttcaaacacagccacggccgtcatcacagtgacagatgtcaatgacaatcctcca
gagtttactgccatgacgttttatggtgaagttcctgagaacagggtagacatcatagta
gctaatctaactgtgaccgataaggatcaaccccatacaccagcctggaacgcagtgtac
agaatcagtggcggagatcctactggacggttcgccatccagaccgacccaaacagcaac
gacgggttagtcaccgtggtcaaaccaatcgactttgaaacaaataggatgtttgtcctt
actgttgctgcagaaaatcaagtgccattagccaagggaattcagcacccgcctcagtca
actgcaaccgtgtctgttacagttattgacgtaaatgaaaacccttattttgcccccaat
cctaagatcattcgccaagaagaagggcttcatgccggtaccatgttgacaacattcact
gctcaggacccagatcgatatatgcagcaaaatattagatacactaaattatctgatcct
gccaattggctaaaaatagatcctgtgaatggacaaataactacaattgctgttttggac
cgagaatcaccaaatgtgaaaaacaatatatataatgctactttccttgcttctgacaat
ggaattcctcctatgagtggaacaggaacgctgcagatctatttacttgatattaatgac
aatgcccctcaagtgttacctcaagaggcagagacttgcgaaactccagaccccaattca
attaatattacagcacttgattatgacattgatccaaatgctggaccatttgcttttgat
cttcctttatctccagtgactattaagagaaattggaccatcactcggcttaatggtgat
tttgctcagcttaatttaaagataaaatttcttgaagctggtatctatgaagttcccatc
ataatcacagattcgggtaatcctcccaaatcaaatatttccatcctgcgcgtgaaggtt
tgccagtgtgactccaacggggactgcacagatgtggacaggattgtgggtgcggggctt
ggcaccggtgccatcattgccatcctgctctgcatcatcatcctgcttatccttgtgctg
atgtttgtggtatggatgaaacgccgggataaagaacgccaggccaaacaacttttaatt
gatccagaagatgatgtaagagataatattttaaaatatgatgaagaaggtggaggagaa
gaagaccaggactatgacttgagccagctgcagcagcctgacactgtggagcctgatgcc
atcaagcctgtgggaatccgacgaatggatgaaagacccatccacgccgagccccagtat
ccggtccgatctgcagccccacaccctggagacattggggacttcattaatgagggcctt
aaagcggctgacaatgaccccacagctccaccatatgactccctgttagtgtttgactat
gaaggcagtggctccactgctgggtccttgagctcccttaattcctcaagtagtggtggt
gagcaggactatgattacctgaacgactgggggccacggttcaagaaacttgctgacatg
tatggtggaggtgatgactga

DBGET integrated database retrieval system