KEGG   Homo sapiens (human): 10000Help
Entry
10000             CDS       T01001                                 

Gene name
AKT3, MPPH, MPPH2, PKB-GAMMA, PKBG, PRKBG, RAC-PK-gamma, RAC-gamma, STK-2
Definition
(RefSeq) AKT serine/threonine kinase 3
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa01522  Endocrine resistance
hsa01524  Platinum drug resistance
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04068  FoxO signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04140  Autophagy - animal
hsa04150  mTOR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04210  Apoptosis
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04218  Cellular senescence
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04370  VEGF signaling pathway
hsa04371  Apelin signaling pathway
hsa04380  Osteoclast differentiation
hsa04510  Focal adhesion
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04611  Platelet activation
hsa04620  Toll-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04668  TNF signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa04725  Cholinergic synapse
hsa04728  Dopaminergic synapse
hsa04910  Insulin signaling pathway
hsa04914  Progesterone-mediated oocyte maturation
hsa04915  Estrogen signaling pathway
hsa04917  Prolactin signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04922  Glucagon signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04926  Relaxin signaling pathway
hsa04929  GnRH secretion
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04935  Growth hormone synthesis, secretion and action
hsa04973  Carbohydrate digestion and absorption
hsa05131  Shigellosis
hsa05135  Yersinia infection
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05210  Colorectal cancer
hsa05211  Renal cell carcinoma
hsa05212  Pancreatic cancer
hsa05213  Endometrial cancer
hsa05214  Glioma
hsa05215  Prostate cancer
hsa05218  Melanoma
hsa05220  Chronic myeloid leukemia
hsa05221  Acute myeloid leukemia
hsa05222  Small cell lung cancer
hsa05223  Non-small cell lung cancer
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
hsa05230  Central carbon metabolism in cancer
hsa05231  Choline metabolism in cancer
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06114  PI3K signaling (viruses)
nt06124  Chemokine signaling (viruses)
nt06135  Cytoskeletal regulation (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06214  PI3K signaling
nt06224  CXCR signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06262  Pancreatic cancer
nt06263  Hepatocellular carcinoma
nt06264  Renal cell carcinoma
nt06266  Non-small cell lung cancer
nt06267  Small cell lung cancer
nt06268  Melanoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06272  Prostate cancer
nt06273  Glioma
nt06275  Acute myeloid leukemia
nt06276  Chronic myeloid leukemia
  Element
N00030  EGF-EGFR-RAS-PI3K signaling pathway
N00031  Duplication or mutation-activated FLT3 to RAS-PI3K signaling pathway
N00032  Mutation-activated KRAS/NRAS to PI3K signaling pathway
N00033  EGF-EGFR-PI3K signaling pathway
N00034  ERBB2-overexpression to PI3K signaling pathway
N00035  Amplified EGFR to PI3K signaling pathway
N00036  Mutation-activated EGFR to PI3K signaling pathway
N00037  FGF-FGFR-PI3K signaling pathway
N00038  Amplified FGFR to PI3K signaling pathway
N00039  PDGF-PDGFR-PI3K signaling pathway
N00040  Amplified PDGFR to PI3K signaling pathway
N00042  EGFR-overexpression to PI3K signaling pathway
N00043  HGF-MET-PI3K signaling pathway
N00044  Mutation-activated MET to PI3K signaling pathway
N00045  KITLG-KIT-PI3K signaling pathway
N00046  Mutation-activated KIT to PI3K signaling pathway
N00047  EML4-ALK fusion kinase to PI3K signaling pathway
N00048  BCR-ABL fusion kinase to PI3K signaling pathway
N00049  Mutation-activated PI3K to PI3K signaling pathway
N00050  Amplified PI3K to PI3K signaling pathway
N00051  Deleted PTEN to PI3K signaling pathway
N00052  Mutation-inactivated PTEN to PI3K signaling pathway
N00082  Loss of NKX3-1 to PI3K signaling pathway
N00154  CXCR-GNB/G-PI3K-AKT signaling pathway
N00158  KSHV vGPCR to GNB/G-PI3K-AKT signaling pathway
N00159  KSHV K1 to PI3K signaling pathway
N00179  KSHV K1 to PI3K-NFKB signaling pathway
N00182  IGF-IGFR-PI3K-NFKB signaling pathway
N00218  FLT3LG-FLT3-RAS-PI3K signaling pathway
N00220  PTEN-PIP3-AKT signaling pathway
N00231  TGFA-EGFR-PI3K signaling pathway
N00232  TGFA-overexpression to PI3K signaling pathway
N00234  IGF2-IGF1R-PI3K signaling pathway
N00236  IGF2-overexpression to PI3K signaling pathway
N00238  IGF1R-overexpression to PI3K signaling pathway
N00247  HGF-overexpression to PI3K signaling pathway
N00249  MET-overexpression to PI3K signaling pathway
N00253  Amplified ERBB2 to PI3K signaling pathway
N00260  Amplified MET to PI3K signaling pathway
N00267  HBV HBx to PI3K signaling pathway
N00272  HCV NS5A to PI3K signaling pathway
N00281  EGF-overexpression to PI3K signaling pathway
N00282  EREG-EGFR-PI3K signaling pathway
N00283  EREG-overexpression to PI3K signaling pathway
N00284  AREG-EGFR-PI3K signaling pathway
N00285  AREG-overexpression to PI3K signaling pathway
N00342  MAGI-PTEN signaling pathway
N00353  HPV E6 to PTEN-PIP3-AKT signaling pathway
N00354  HPV E6 to PTEN-PIP3-AKT signaling pathway
N00355  PP2A-AKT signaling pathway
N00356  HPV E7 to PP2A-AKT signaling patyway
N00366  HPV E5 to EGFR-PI3K signaling pathway
N00368  HPV E5 to PDGFR-PI3K signaling pathway
N00385  HCMV gB to PDGFR-PI3K signaling pathway
N00387  HCMV IE1-72/IE2-86 to PI3K signaling pathway
N00390  EGF-EGFR-PI3K-NFKB signaling pathway
N00391  HCMV gB to EGFR-PI3K-NFKB signaling pathway
N00399  CCR2-GNB/G-PI3K-NFKB signaling pathway
N00400  HCMV US28 to GNB/G-PI3K-NFKB signaling pathway
N00430  CXCR4-GNAI-PI3K-BAD signaling pathway
N00431  HIV gp120 to CXCR4-GNAI-PI3K-BAD signaling pathway
N00485  EBV LMP1 to PI3K signaling pathway
N00501  HTLV-1 Tax to EGFR-PI3K-NFKB signaling pathway
N00502  HTLV-1 Tax to PTEN-PIP3-AKT signaling pathway
N00514  Mutation-activated EGFR to PI3K signaling pathway
N00582  IGF-IGF1R-PI3K signaling pathway
N00583  HSV VP11/12 to PI3K signaling pathway
N00683  CD80/CD86-CD28-PI3K signaling pathway
N00684  MV F/H to CD28-PI3K signaling pathway
N00736  IAV NS1 to PI3K signaling pathway
Disease
H01885  Megalencephaly-polymicrogyria-polydactyly-hydrocephalus syndrome
Drug target
Afuresertib (DG01408): D10381 D10382
Capivasertib: D11371
Ipatasertib (DG02851): D10641 D11074
Miransertib (DG03026): D11409 D11508
Triciribine phosphate: D06221
Uprosertib: D10674
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    10000 (AKT3)
   04015 Rap1 signaling pathway
    10000 (AKT3)
   04010 MAPK signaling pathway
    10000 (AKT3)
   04012 ErbB signaling pathway
    10000 (AKT3)
   04370 VEGF signaling pathway
    10000 (AKT3)
   04371 Apelin signaling pathway
    10000 (AKT3)
   04630 Jak-STAT signaling pathway
    10000 (AKT3)
   04668 TNF signaling pathway
    10000 (AKT3)
   04066 HIF-1 signaling pathway
    10000 (AKT3)
   04068 FoxO signaling pathway
    10000 (AKT3)
   04072 Phospholipase D signaling pathway
    10000 (AKT3)
   04071 Sphingolipid signaling pathway
    10000 (AKT3)
   04024 cAMP signaling pathway
    10000 (AKT3)
   04022 cGMP-PKG signaling pathway
    10000 (AKT3)
   04151 PI3K-Akt signaling pathway
    10000 (AKT3)
   04152 AMPK signaling pathway
    10000 (AKT3)
   04150 mTOR signaling pathway
    10000 (AKT3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    10000 (AKT3)
  09143 Cell growth and death
   04210 Apoptosis
    10000 (AKT3)
   04218 Cellular senescence
    10000 (AKT3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    10000 (AKT3)
   04550 Signaling pathways regulating pluripotency of stem cells
    10000 (AKT3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    10000 (AKT3)
   04620 Toll-like receptor signaling pathway
    10000 (AKT3)
   04625 C-type lectin receptor signaling pathway
    10000 (AKT3)
   04660 T cell receptor signaling pathway
    10000 (AKT3)
   04662 B cell receptor signaling pathway
    10000 (AKT3)
   04664 Fc epsilon RI signaling pathway
    10000 (AKT3)
   04666 Fc gamma R-mediated phagocytosis
    10000 (AKT3)
   04062 Chemokine signaling pathway
    10000 (AKT3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    10000 (AKT3)
   04922 Glucagon signaling pathway
    10000 (AKT3)
   04923 Regulation of lipolysis in adipocytes
    10000 (AKT3)
   04920 Adipocytokine signaling pathway
    10000 (AKT3)
   04929 GnRH secretion
    10000 (AKT3)
   04915 Estrogen signaling pathway
    10000 (AKT3)
   04914 Progesterone-mediated oocyte maturation
    10000 (AKT3)
   04917 Prolactin signaling pathway
    10000 (AKT3)
   04926 Relaxin signaling pathway
    10000 (AKT3)
   04935 Growth hormone synthesis, secretion and action
    10000 (AKT3)
   04919 Thyroid hormone signaling pathway
    10000 (AKT3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    10000 (AKT3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    10000 (AKT3)
  09156 Nervous system
   04725 Cholinergic synapse
    10000 (AKT3)
   04728 Dopaminergic synapse
    10000 (AKT3)
   04722 Neurotrophin signaling pathway
    10000 (AKT3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    10000 (AKT3)
  09149 Aging
   04211 Longevity regulating pathway
    10000 (AKT3)
   04213 Longevity regulating pathway - multiple species
    10000 (AKT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    10000 (AKT3)
   05205 Proteoglycans in cancer
    10000 (AKT3)
   05230 Central carbon metabolism in cancer
    10000 (AKT3)
   05231 Choline metabolism in cancer
    10000 (AKT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    10000 (AKT3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    10000 (AKT3)
   05212 Pancreatic cancer
    10000 (AKT3)
   05225 Hepatocellular carcinoma
    10000 (AKT3)
   05226 Gastric cancer
    10000 (AKT3)
   05214 Glioma
    10000 (AKT3)
   05221 Acute myeloid leukemia
    10000 (AKT3)
   05220 Chronic myeloid leukemia
    10000 (AKT3)
   05218 Melanoma
    10000 (AKT3)
   05211 Renal cell carcinoma
    10000 (AKT3)
   05215 Prostate cancer
    10000 (AKT3)
   05213 Endometrial cancer
    10000 (AKT3)
   05224 Breast cancer
    10000 (AKT3)
   05222 Small cell lung cancer
    10000 (AKT3)
   05223 Non-small cell lung cancer
    10000 (AKT3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    10000 (AKT3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    10000 (AKT3)
   04931 Insulin resistance
    10000 (AKT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    10000 (AKT3)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    10000 (AKT3)
   05135 Yersinia infection
    10000 (AKT3)
   05152 Tuberculosis
    10000 (AKT3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    10000 (AKT3)
   05170 Human immunodeficiency virus 1 infection
    10000 (AKT3)
   05162 Measles
    10000 (AKT3)
   05164 Influenza A
    10000 (AKT3)
   05161 Hepatitis B
    10000 (AKT3)
   05160 Hepatitis C
    10000 (AKT3)
   05168 Herpes simplex virus 1 infection
    10000 (AKT3)
   05163 Human cytomegalovirus infection
    10000 (AKT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    10000 (AKT3)
   05169 Epstein-Barr virus infection
    10000 (AKT3)
   05165 Human papillomavirus infection
    10000 (AKT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    10000 (AKT3)
   05142 Chagas disease (American trypanosomiasis)
    10000 (AKT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    10000 (AKT3)
   01524 Platinum drug resistance
    10000 (AKT3)
   01522 Endocrine resistance
    10000 (AKT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    10000 (AKT3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     10000 (AKT3)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   10000 (AKT3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PH Pkinase_C Kinase-like FTA2 PH_11 APH
Motif
Other DBs
NCBI-GeneID: 10000
NCBI-ProteinID: NP_005456
OMIM: 611223
HGNC: 393
Ensembl: ENSG00000117020
Vega: OTTHUMG00000039994
Pharos: Q9Y243(Tchem)
UniProt: Q9Y243
Structure
PDB: 

Position
1q43-q44
AA seq 479 aa AA seqDB search
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatgttaccattgtgaaagaaggttgggttcagaagaggggagaatatataaaa
aactggaggccaagatacttccttttgaagacagatggctcattcataggatataaagag
aaacctcaagatgtggatttaccttatcccctcaacaacttttcagtggcaaaatgccag
ttaatgaaaacagaacgaccaaagccaaacacatttataatcagatgtctccagtggact
actgttatagagagaacatttcatgtagatactccagaggaaagggaagaatggacagaa
gctatccaggctgtagcagacagactgcagaggcaagaagaggagagaatgaattgtagt
ccaacttcacaaattgataatataggagaggaagagatggatgcctctacaacccatcat
aaaagaaagacaatgaatgattttgactatttgaaactactaggtaaaggcacttttggg
aaagttattttggttcgagagaaggcaagtggaaaatactatgctatgaagattctgaag
aaagaagtcattattgcaaaggatgaagtggcacacactctaactgaaagcagagtatta
aagaacactagacatccctttttaacatccttgaaatattccttccagacaaaagaccgt
ttgtgttttgtgatggaatatgttaatgggggcgagctgtttttccatttgtcgagagag
cgggtgttctctgaggaccgcacacgtttctatggtgcagaaattgtctctgccttggac
tatctacattccggaaagattgtgtaccgtgatctcaagttggagaatctaatgctggac
aaagatggccacataaaaattacagattttggactttgcaaagaagggatcacagatgca
gccaccatgaagacattctgtggcactccagaatatctggcaccagaggtgttagaagat
aatgactatggccgagcagtagactggtggggcctaggggttgtcatgtatgaaatgatg
tgtgggaggttacctttctacaaccaggaccatgagaaactttttgaattaatattaatg
gaagacattaaatttcctcgaacactctcttcagatgcaaaatcattgctttcagggctc
ttgataaaggatccaaataaacgccttggtggaggaccagatgatgcaaaagaaattatg
agacacagtttcttctctggagtaaactggcaagatgtatatgataaaaagcttgtacct
ccttttaaacctcaagtaacatctgagacagatactagatattttgatgaagaatttaca
gctcagactattacaataacaccacctgaaaaatatgatgaggatggtatggactgcatg
gacaatgagaggcggccgcatttccctcaattttcctactctgcaagtggacgagaataa

DBGET integrated database retrieval system