KEGG   Homo sapiens (human): 10003
Entry
10003             CDS       T01001                                 
Symbol
NAALAD2, GCP3, GCPIII, GPCIII
Name
(RefSeq) N-acetylated alpha-linked acidic dipeptidase 2
  KO
K01301  N-acetylated-alpha-linked acidic dipeptidase [EC:3.4.17.21]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    10003 (NAALAD2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.21  glutamate carboxypeptidase II
     10003 (NAALAD2)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M28: aminopeptidase Y family
   10003 (NAALAD2)
SSDB
Motif
Pfam: TFR_dimer Peptidase_M28 PA Nicastrin FCH
Other DBs
NCBI-GeneID: 10003
NCBI-ProteinID: NP_005458
OMIM: 611636
HGNC: 14526
Ensembl: ENSG00000077616
UniProt: Q9Y3Q0
Position
11:90131699..90192894
AA seq 740 aa
MAESRGRLYLWMCLAAALASFLMGFMVGWFIKPLKETTTSVRYHQSIRWKLVSEMKAENI
KSFLRSFTKLPHLAGTEQNFLLAKKIQTQWKKFGLDSAKLVHYDVLLSYPNETNANYISI
VDEHETEIFKTSYLEPPPDGYENVTNIVPPYNAFSAQGMPEGDLVYVNYARTEDFFKLER
EMGINCTGKIVIARYGKIFRGNKVKNAMLAGAIGIILYSDPADYFAPEVQPYPKGWNLPG
TAAQRGNVLNLNGAGDPLTPGYPAKEYTFRLDVEEGVGIPRIPVHPIGYNDAEILLRYLG
GIAPPDKSWKGALNVSYSIGPGFTGSDSFRKVRMHVYNINKITRIYNVVGTIRGSVEPDR
YVILGGHRDSWVFGAIDPTSGVAVLQEIARSFGKLMSKGWRPRRTIIFASWDAEEFGLLG
STEWAEENVKILQERSIAYINSDSSIEGNYTLRVDCTPLLYQLVYKLTKEIPSPDDGFES
KSLYESWLEKDPSPENKNLPRINKLGSGSDFEAYFQRLGIASGRARYTKNKKTDKYSSYP
VYHTIYETFELVEKFYDPTFKKQLSVAQLRGALVYELVDSKIIPFNIQDYAEALKNYAAS
IYNLSKKHDQQLTDHGVSFDSLFSAVKNFSEAASDFHKRLIQVDLNNPIAVRMMNDQLML
LERAFIDPLGLPGKLFYRHIIFAPSSHNKYAGESFPGIYDAIFDIENKANSRLAWKEVKK
HISIAAFTIQAAAGTLKEVL
NT seq 2223 nt   +upstreamnt  +downstreamnt
atggcggaatccaggggccgtctgtacctttggatgtgcttggctgctgcgctggcatct
ttcctgatgggatttatggtgggctggtttattaagcctctcaaagaaacgaccacttct
gtgcgctatcatcaaagtatacggtggaaactggtatccgaaatgaaagctgaaaacatc
aaatcatttcttcgttcttttacaaagcttcctcatctggcaggaacagaacaaaatttc
ttgcttgccaagaaaatccaaacccagtggaagaaatttggactagattcagccaagttg
gttcattatgatgtcctcttatcttaccccaatgagacaaatgccaactatatatcgatt
gtggatgaacatgaaactgagattttcaaaacatcataccttgaaccaccaccagatggc
tatgagaatgttacaaatattgtgccaccatataatgctttctcagcccaaggcatgcca
gagggagatcttgtatatgtgaactatgctcgcactgaagactttttcaaactagaaaga
gagatgggcatcaactgtactgggaagattgttattgcaagatatggaaaaatcttcaga
ggaaataaagttaaaaatgccatgttagcaggagccataggaatcatcttgtactcagat
ccagctgactactttgctcctgaggtacagccatatcccaaaggatggaatcttcctgga
actgcagcccagagaggaaatgtgttaaatttgaatggtgctggtgacccactcactcca
ggctatccagcaaaagaatacactttcagacttgatgttgaagaaggagtgggaatcccc
cgaatacctgtacatcccattggatataatgatgcagaaatattattacgctacttggga
ggaattgctccaccagataagagttggaagggagcccttaatgtgagttatagtatcgga
cctggctttacagggagtgattctttcaggaaggttagaatgcatgtttataacatcaat
aaaattacaaggatttacaatgtagttggaactatcagaggatctgtggaacctgacagg
tatgttattctgggaggtcaccgggactcctgggtatttggagctattgacccaaccagt
ggggttgctgttttgcaagaaattgcccggagttttggaaaactgatgagtaaaggctgg
agacctagaagaactatcatttttgccagctgggatgcagaagaatttggacttctgggt
tccacagaatgggctgaggagaatgtcaaaatactccaggagagaagcattgcttatatc
aactcggattcatctatagaaggcaattatactctcagagttgactgtactccccttctt
taccaattagtgtataaactgacaaaagagatccccagccctgatgatgggtttgagagt
aaatcactgtatgaaagctggttggaaaaagacccttcacctgaaaataaaaatttgcct
agaatcaataagctgggatctggaagtgactttgaagcttattttcagagacttggaatt
gcttcaggcagagcccgttacactaagaataagaaaacagataagtacagcagctaccca
gtgtaccacacaatttatgagacatttgaattggtagagaaattttatgaccccacattt
aaaaaacaactttctgtggctcaattacgaggagcactggtatatgagcttgtggattct
aaaatcattccttttaatattcaagactatgcagaagctttgaaaaactatgcagcaagt
atctataatctatctaagaaacatgatcaacaattgacagaccatggagtatcatttgac
tccttattttctgctgtgaaaaacttctcagaggctgcttcagattttcataaacgactt
atacaagttgatcttaacaatcccattgcagtgagaatgatgaatgaccaactgatgctc
ctggaaagagcattcatcgatcctcttggtttaccaggaaagctgttctataggcacatc
atatttgctccaagtagccacaacaaatatgctggagaatcatttcctggaatctatgat
gctatctttgatattgaaaataaagccaactctcgtttggcctggaaagaagtaaagaaa
catatttctattgcagcttttacaattcaagcagcagcaggaactctgaaagaagtatta
tag

DBGET integrated database retrieval system