KEGG   Homo sapiens (human): 10004
Entry
10004             CDS       T01001                                 

Gene name
NAALADL1, I100, NAALADASEL
Definition
(RefSeq) N-acetylated alpha-linked acidic dipeptidase like 1
  KO
K01301  N-acetylated-alpha-linked acidic dipeptidase [EC:3.4.17.21]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    10004 (NAALADL1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.21  glutamate carboxypeptidase II
     10004 (NAALADL1)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M28: aminopeptidase Y family
   10004 (NAALADL1)
SSDB
Motif
Pfam: TFR_dimer Peptidase_M28 PA Nicastrin Peptidase_M20
Other DBs
NCBI-GeneID: 10004
NCBI-ProteinID: NP_005459
OMIM: 602640
HGNC: 23536
Ensembl: ENSG00000168060
Vega: OTTHUMG00000165595
Pharos: Q9UQQ1(Tbio)
UniProt: Q9UQQ1
Structure
PDB: 
4TWE

Position
11q13.1
AA seq 740 aa
MQWTKVLGLGLGAAALLGLGIILGHFAIPKKANSLAPQDLDLEILETVMGQLDAHRIREN
LRELSREPHLASSPRDEDLVQLLLQRWKDPESGLDSAEASTYEVLLSFPSQEQPNVVDIV
GPTGGIIHSCHRTEENVTGEQGGPDVVQPYAAYAPSGTPQGLLVYANRGAEEDFKELQTQ
GIKLEGTIALTRYGGVGRGAKAVNAAKHGVAGVLVYTDPADINDGLSSPDETFPNSWYLP
PSGVERGSYYEYFGDPLTPYLPAVPSSFRVDLANVSGFPPIPTQPIGFQDARDLLCNLNG
TLAPATWQGALGCHYRLGPGFRPDGDFPADSQVNVSVYNRLELRNSSNVLGIIRGAVEPD
RYVLYGNHRDSWVHGAVDPSSGTAVLLELSRVLGTLLKKGTWRPRRSIVFASWGAEEFGL
IGSTEFTEEFFNKLQERTVAYINVDISVFANATLRVQGTPPVQSVVFSATKEIRSPGPGD
LSIYDNWIRYFNRSSPVYGLVPSLGSLGAGSDYAPFVHFLGISSMDIAYTYDRSKTSARI
YPTYHTAFDTFDYVDKFLDPGFSSHQAVARTAGSVILRLSDSFFLPLKVSDYSETLRSFL
QAAQQDLGALLEQHSISLGPLVTAVEKFEAEAAALGQRISTLQKGSPDPLQVRMLNDQLM
LLERTFLNPRAFPEERYYSHVLWAPRTGSVVTFPGLSNACSRARDTASGSEAWAEVQRQL
SIVVTALEGAAATLRPVADL
NT seq 2223 nt   +upstreamnt  +downstreamnt
atgcagtggacgaaggtgttggggctggggctgggggctgctgccctcttggggctgggg
atcatcctcggccactttgccatccccaaaaaagccaactcactggccccccaggacctg
gacctggagatcctggagaccgtcatggggcagctggatgcccacaggatccgggagaac
ctcagagaactctccagggagccacacctggcctccagccctcgggatgaggacctggtg
cagctgctgctgcagcgctggaaggacccagagtcaggcctggactcggccgaggcctcc
acgtacgaagtgctgctgtccttccctagccaggagcagcccaacgtcgtggacatcgtg
ggccccactgggggcatcatccactcctgccaccggactgaggagaacgtgaccggggag
caaggggggccagatgtggtacaaccctatgctgcctatgctccttctggaaccccacag
ggcctcctcgtctatgccaaccggggcgcggaagaagactttaaggagctacagactcag
ggcatcaaacttgaaggcaccattgccctgactcgatatgggggtgtagggcgtggggcc
aaggctgtgaacgctgccaagcacggggtagctggggtgctggtgtacacagaccctgcc
gacatcaacgatgggctgagctcacccgacgaaacctttcccaactcctggtacctgccc
ccctcaggagtggagcgaggctcctactacgagtattttggggaccctctgactccctac
cttccagccgtcccctcttccttccgcgtggaccttgccaatgtctccggatttccccca
attcctacacagcccattggcttccaggatgcaagagacctgctctgtaacctcaacgga
actttggccccagccacctggcagggagcactgggctgccactacaggttgggtcccggc
ttccggcctgacggagacttcccagcagacagccaggtgaatgtgagcgtctacaaccgc
ctggagctgaggaactcttccaacgtcctgggcatcatccgtggggctgtggagcctgat
cgctacgtgctgtatgggaaccaccgagacagctgggtgcacggggctgtggaccccagc
agtggcaccgccgtcctcctggagctctcccgtgtcctggggaccctgctgaagaagggc
acctggcgtcctcgcagatcaatcgtgtttgcgagctggggggctgaggagtttgggctc
attggctccacggaattcacagaagagttcttcaacaagctgcaggagcgcacggtggcc
tacatcaacgtggacatctcggtgtttgccaacgctacccttagggtgcaggggacgccc
cctgtccagagcgtcgtcttctctgcaaccaaagagatccgctcaccaggccctggcgac
ctgagcatctacgacaactggatccggtacttcaaccgcagcagcccggtgtacggcctg
gtccccagcttgggttctctgggtgctggcagcgactatgcacccttcgttcacttcctg
ggcatctcctccatggacattgcctatacctatgaccggagcaagacttcagccaggatc
taccccacctaccacacagcctttgacacctttgactatgtggacaagtttttggacccg
ggcttcagcagccatcaggctgtggcccggacagcggggagtgtgattctccggctcagt
gacagcttcttcctgcccctcaaagtcagtgactacagtgagacactccgcagcttcctg
caggcagcccagcaagatcttggggccctgctggagcagcacagcatcagcctggggcct
ctggtgactgcagtggagaagtttgaggcagaagctgcagccttgggccaacgcatatca
acactgcagaagggcagccctgaccccctgcaggtccggatgctcaatgaccagttgatg
ctcttggaacggacctttctgaaccctagagccttcccagaggaacgctactacagccat
gtgctctgggcacctcgcacgggctccgtagtcacattcccgggcctatccaatgcctgc
tccagggccagggacacagcttctggatctgaagcttgggctgaggtccagagacagctc
agcattgtggtgacagccctggagggtgcggcagccaccctgaggcctgtggctgacctc
tga

DBGET integrated database retrieval system