KEGG   Homo sapiens (human): 10006
Entry
10006             CDS       T01001                                 

Gene name
ABI1, ABI-1, ABLBP4, E3B1, NAP1BP, SSH3BP, SSH3BP1
Definition
(RefSeq) abl interactor 1
  KO
K23649  abl interactor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05130  Pathogenic Escherichia coli infection
hsa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    10006 (ABI1)
   05132 Salmonella infection
    10006 (ABI1)
SSDB
Motif
Pfam: Abi_HHR SH3_1 SH3_9 SH3_2 ATP-synt_ab_Xtn GP3_package
Other DBs
NCBI-GeneID: 10006
NCBI-ProteinID: NP_005461
OMIM: 603050
HGNC: 11320
Ensembl: ENSG00000136754
Vega: OTTHUMG00000017848
Pharos: Q8IZP0(Tbio)
UniProt: Q8IZP0
Position
10p12.1
AA seq 508 aa
MAELQMLLEEEIPSGKRALIESYQNLTRVADYCENNYIQATDKRKALEETKAYTTQSLAS
VAYQINALANNVLQLLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTTNKNTSR
THKIIAPANMERPVRYIRKPIDYTVLDDVGHGVKWLKAKHGNNQPARTGTLSRTNPPTQK
PPSPPMSGRGTLGRNTPYKTLEPVKPPTVPNDYMTSPARLGSQHSPGRTASLNQRPRTHS
GSSGGSGSRENSGSSSIGIPIAVPTPSPPTIGPENISVPPPSGAPPAPPLAPLLPVSTVI
AAPGSAPGSQYGTMTRQISRHNSTTSSTSSGGYRRTPSVTAQFSAQPHVNGGPLYSQNSI
SIAPPPPPMPQLTPQIPLTGFVARVQENIADSPTPPPPPPPDDIPMFDDSPPPPPPPPVD
YEDEEAAVVQYNDPYADGDPAWAPKNYIEKVVAIYDYTKDKDDELSFMEGAIIYVIKKND
DGWYEGVCNRVTGLFPGNYVESIMHYTD
NT seq 1527 nt   +upstreamnt  +downstreamnt
atggcagagctgcagatgttactagaggaggagatcccgtctggcaagagggcgctgatc
gagagttaccagaacctgactcgggtggcagactactgtgaaaacaactacatacaggct
acagacaagagaaaagctttagaggagaccaaagcctatacaacccaatctctagctagt
gttgcttatcaaataaatgcattggccaacaatgtactccagttgctggatatccaagcc
tctcagcttcggagaatggagtcttccatcaatcatatctcacagactgtggatattcat
aaggagaaagtggcacgaagagagattggtattttgacaacaaataagaatacatcaaga
actcacaaaataatagcacctgcgaatatggagcgccctgtaaggtatattcggaaacct
atcgattacacagttctggatgatgtgggccatggtgtcaagtggctaaaagccaagcat
ggaaataaccagcctgcaagaactggcacactgtcgagaacaaatcctcctactcagaaa
ccgccaagtcctcccatgtcaggccggggaacactgggacggaatactccttataaaacc
ctggaacctgttaaacccccaacagttcctaatgactatatgaccagtcctgctaggctt
ggaagtcagcatagtccaggcaggacagcatctttaaatcagagaccaaggacacacagt
ggaagtagtggaggaagtggaagtcgagaaaacagtggtagcagtagtattggcattccc
attgctgtgcctacaccttcgccacccactattggaccagaaaacatttctgtccctcct
ccttctggagctccaccagcaccacctctggcaccacttctcccagtgagcactgtgata
gcagccccgggctcagctcctggttcccagtatggcacaatgaccaggcagatatctcga
cacaactctactacttcttcgacatcttctggtggatacagacgaactccctctgtgact
gctcaattttctgctcagcctcatgttaatggaggtccactttattctcaaaattcaatt
tctattgctccaccccctccccctatgcctcagttgactccacagatacctctcacaggc
ttcgtggccagggtgcaggaaaacattgctgatagtccaactccaccgccaccacctcca
ccagatgacattcccatgtttgatgactctccacctcccccaccaccaccaccagtggat
tatgaagatgaggaggctgcagtagttcagtataatgatccatatgcagatggggatcct
gcttgggcccccaagaattatattgagaaagttgttgcaatatatgattatacaaaagac
aaggatgatgagctgtcatttatggagggtgcaatcatttatgttataaagaagaatgat
gatggctggtatgaaggagtctgcaatcgagtgactggtctgttccctgggaactatgtt
gaatcaatcatgcactatactgattaa

DBGET integrated database retrieval system