KEGG   Homo sapiens (human): 10010Help
Entry
10010             CDS       T01001                                 

Gene name
TANK, I-TRAF, ITRAF, TRAF2
Definition
(RefSeq) TRAF family member associated NFKB activator
  KO
K12650  TRAF family member-associated NF-kappa-B activator
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    10010 (TANK)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    10010 (TANK)
   04622 RIG-I-like receptor signaling pathway
    10010 (TANK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TBD DUF3713 PspA_IM30 FliD_N MRF_C1 PKcGMP_CC AAA_13
Motif
Other DBs
NCBI-GeneID: 10010
NCBI-ProteinID: NP_001186064
OMIM: 603893
HGNC: 11562
Ensembl: ENSG00000136560
Vega: OTTHUMG00000132037
Pharos: Q92844(Tbio)
UniProt: Q92844 B2R7S3 Q6NW12
Position
2q24.2
AA seq 425 aa AA seqDB search
MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKS
QLLLVNSTQDNNYGCVPLLEDSETRKNNLTLDQPQDKVISGIAREKLPKVRRQEVSSPRK
ETSARSLGSPLLHERGNIEKTFWDLKEEFHKICMLAKAQKDHLSKLNIPDTATETQCSVP
IQCTDKTDKQEALFKPQAKDDINRGAPSITSVTPRGLCRDEEDTSFESLSKFNVKFPPMD
NDSTFLHSTPERPGILSPATSEAVCQEKFNMEFRDNPGNFVKTEETLFEIQGIDPIASAI
QNLKTTDKTKPSNLVNTCIRTTLDRAACLPPGDHNALYVNSFPLLDPSDAPFPSLDSPGK
AIRGPQQPIWKPFPNQDSDSVVLSGTDSELHIPRVCEFCQAVFPPSITSRGDFLRHLNSH
FNGET
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaacattggcgagcaactcaataaagcgtatgaagccttccggcaggcatgc
atggatagagattctgcagtaaaagaattacagcaaaagactgagaactatgagcagaga
atacgtgaacaacaggaacagctgtcacttcaacagactattattgacaagctaaaatct
cagttacttcttgtgaattccactcaagataacaattatggctgtgttcctctgcttgaa
gacagtgaaacaagaaagaataatttgactcttgatcagccacaagataaagtgatttca
ggaatagcaagagaaaaactaccaaaggtaagaagacaagaggtttcttctcctagaaaa
gaaacttcagcaaggagtcttggcagtcctttgctccatgaaaggggtaatatagagaag
actttctgggatctgaaagaagaatttcataaaatatgcatgctagcaaaagcacagaaa
gaccacttaagcaaacttaatataccagacactgcaactgaaacacagtgctctgtgcct
atacagtgtacggataaaacagataaacaagaagcgctgtttaagcctcaggctaaagat
gatataaatagaggtgcaccatccatcacatctgtcacaccaagaggactgtgcagagat
gaggaagacacctcttttgaatcactttctaaattcaatgtcaagtttccacctatggac
aatgactcaactttcttacatagcactccagagagacccggcatccttagtcctgccacg
tctgaggcagtgtgccaagagaaatttaatatggagttcagagacaacccagggaacttt
gttaaaacagaagaaactttatttgaaattcagggaattgaccccatagcttcagctata
caaaaccttaaaacaactgacaaaacaaagccctcaaatctcgtaaacacttgtatcagg
acaactctggatagagctgcgtgtttgccacctggagaccataatgcattatatgtaaat
agcttcccacttctggacccatctgatgcaccttttccctcactcgattccccgggaaaa
gcaatccgaggaccacagcagcccatttggaagccctttcctaatcaagacagtgactcg
gtggtactaagtggcacagactcagaactgcatatacctcgagtatgtgaattctgtcaa
gcagttttcccaccatccattacatccaggggggatttccttcggcatcttaattcacac
ttcaatggagagacttaa

DBGET integrated database retrieval system