KEGG   Homo sapiens (human): 100101267Help
Entry
100101267         CDS       T01001                                 

Gene name
POM121C, POM121-2
Definition
(RefSeq) POM121 transmembrane nucleoporin C
  KO
K14316  nuclear pore complex protein Nup121
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
Module
hsa_M00427  Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100101267 (POM121C)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100101267 (POM121C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: POM121
Motif
Other DBs
NCBI-GeneID: 100101267
NCBI-ProteinID: NP_001092885
OMIM: 615754
HGNC: 34005
Ensembl: ENSG00000272391
Vega: OTTHUMG00000156238
UniProt: B4DET5 B4DDR5
Position
7q11.23
AA seq 987 aa AA seqDB search
MVCSPVTVRIAPPDRRFSRSAIPEQIISSTLSSPSSNAPDPCAKETVLSALKEKKKKRTV
EEEDQIFLDGQENKRRRHDSSGSGHSAFEPLVASGVPASFVPKPGSLKRGLNSQSSDDHL
NKRSRSSSMSSLTGAYTSGIPSSSRNAITSSYSSTRGISQLWKRNGPSSSPFSSPASSRS
QTPERPAKKIREEELCHHSSSSTPLAADKESQGEKAADTTPRKKQNSNSQSTPGSSGQRK
RKVQLLPSRRGEQLTLPPPPQLGYSITAEDLDLEKKASLQWFNQALEDKSDAASNSVTET
PPTTQPSFTFTLPAAATASPPTSLLAPSTNPLLESLKKMQTPPSLPPCPESAGAATTEAL
SPPKTPSLLPPLGLSQSGPPGLLPSPSFDSKPPTTLLGLIPAPSMVPATDTKAPPTLQAE
TATKPQATSAPSPAPKQSFLFGTQNTSPSSPAAPAASSASPMFKPIFTAPPKSEKEGLTP
PGPSVSATAPSSSSLPTTTSTTAPTFQPVFSSMGPPASVPLPAPFFKQTTTPATAPTTTA
PLFTGLASATSAVAPITSASPSTDSASKPAFGFGINSVSSSSVSTTTSTATAASQPFLFG
APQASAASFTPAMGSIFQFGKPPALPTTTTVTTFSQSLPTAVPTATSSSAADFSGFGSTL
ATSAPATSSQPTLTFSNTSTPTFNIPFGSSAKSPLPSYPGANPQPAFGAAEGQPPGAAKP
ALTPSFGSSFTFGNSAAPAPATAPTPAPASTIKIVPAHVPTPIQPTFGGATHSAFGLKAT
ASAFGAPASSQPAFGGSTAVFSFGAATSSGFGATTQTASSGSSSSVFGSTTPSPFTFGGS
AAPAGSGSFGINVATPGSSATTGAFSFGAGQSGSTATSTPFTGGLGQNALGTTGQSTPFA
FNVGSTTESKPVFGGTATPTFGQNTPAPGVGTSGSSLSFGASSAPAQGFVGVGPFGSAAP
SFSIGAGSKTPGARQRLQARRQHTRKK
NT seq 2964 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgtagcccagtgactgtgaggatcgcccctcctgacagaagattttcacgttct
gcgataccagagcagataatcagctcaacactgtcgtcaccatcaagtaatgccccagac
ccatgtgcaaaggagactgtactgagtgccctcaaagagaagaagaagaaaaggacagtg
gaggaagaagaccaaatattccttgatggccaggaaaataaaagaaggcgccatgatagc
agtggcagtggacattcagcatttgagcccctggtggccagtggagtccccgcttctttt
gtgcctaagcctgggtctctgaagagaggcctcaattctcagagctcagatgaccacttg
aataagagatcccgaagctcttccatgagctccttgacaggcgcttacacaagtggcatc
cctagctccagccgcaatgccattaccagttcctacagctccactcgaggcatctcacag
ctgtggaagagaaatggccccagttcatcacccttctctagcccagcctcatcccgctcc
cagacaccggagaggccagcaaagaaaataagagaagaagagctgtgtcatcattccagt
tcttcaactccattggcagcagacaaggagtcccagggagaaaaggctgcagatacaacc
ccaaggaagaaacaaaactcgaattctcagtctacacctggcagctctgggcagcgtaag
cggaaagttcagctgctgccttctcggcgaggggaacagctgaccttgcctccacctccc
cagcttggctattcgatcactgccgaggacctagacttagagaagaaggcttcattacag
tggttcaaccaggccttggaggacaagagtgatgctgcctcgaactctgtcactgagacc
ccacctaccactcagccttcatttacctttaccctgcctgctgctgcaactgcctcccca
cccacctccctcctggccccaagcaccaacccactgttagagagcttgaagaagatgcag
actcccccgagcctgccaccctgcccagaatctgctggagcagcaaccactgaggccctc
tcacctccaaagacacccagcctcctacccccgctgggtttatcacagtcagggccgcca
gggctgctccccagcccctcctttgactccaaacccccgaccactttgctggggctgatc
cctgctccatccatggtaccagccactgacaccaaggcacctccaacccttcaggcagag
acggctaccaaaccccaagccacatctgccccgtcccccgcccccaagcaaagcttcctg
tttggaacacagaacacctcaccttccagccctgccgcccctgctgcatcttcagcatct
cccatgttcaagcccattttcacggctccacccaagagtgagaaggaaggcctcacaccg
cctggcccttcagtctcagccacagcgccctccagctcctccctccccacgaccaccagc
accacagccccgaccttccagcctgtctttagcagcatggggccacctgcatctgtgccc
ttgcctgctcccttcttcaagcagacaactactcccgccactgctcccaccacaactgcc
ccgctcttcactggcctggccagcgccacctctgctgtggctcccatcacctctgccagt
ccatccacagactctgcttcgaagcctgcgtttggctttggcataaacagtgtgagcagc
agcagtgtgagtaccacgaccagcaccgccactgccgcctcacagcctttcctcttcggg
gcgccccaggcctctgctgccagcttcaccccggccatgggctccatattccagtttggc
aaacctcctgccttgcccacaaccaccacagtcaccaccttcagccagtccctgcccact
gccgtgccaacggccaccagcagcagcgctgccgactttagtggttttggcagcaccctc
gccacctccgccccggccaccagcagccagcccactctgacgttcagtaacacgagcacc
cccacgttcaacattccctttggctcaagcgccaagtccccgctcccatcatatccggga
gccaacccccagcccgcatttggggccgctgaggggcagccaccgggggccgccaagcca
gcccttacccccagctttggcagctctttcacttttggaaactctgcagccccggccccg
gctactgcacccacacctgcacctgcgtccacgatcaagatcgtgcctgcgcacgtgcct
acgcccatccagcctacctttggcggtgccacgcactcggcgtttggattgaaagccacg
gcttccgccttcggcgctcccgccagctcacagcccgcctttggcggctccactgctgtc
ttctccttcggtgcagccaccagctccggctttggagccaccacccagaccgccagcagc
gggagcagcagctcggtgtttggcagcacaacaccatcacccttcacgtttgggggttcg
gcagcccccgctggcagtgggagctttgggatcaacgtggccaccccaggctccagcgcc
accaccggagctttcagctttggagcaggacagagtgggagcacagccacctccaccccc
ttcacagggggcttaggtcagaacgccctgggcaccaccggccagagcacaccgtttgcc
ttcaacgtgggcagcacaactgagagcaaacctgtgtttggaggcaccgccacccccacc
tttggtcagaacacccctgcgcctggagtgggcacatcgggcagcagcctctcctttggg
gcatcttcagcacccgcccaaggctttgttggtgttggaccgttcggatcggcggcccct
tcattttccattggtgcgggatccaagaccccaggggctcgacagcgactgcaggcccga
aggcagcacacccgcaaaaagtag

DBGET integrated database retrieval system