KEGG   Homo sapiens (human): 100125288Help
Entry
100125288         CDS       T01001                                 

Gene name
ZGLP1, GATAD3, GLP-1, GLP1
Definition
(RefSeq) zinc finger GATA like protein 1
  KO
K21630  GATA-type zinc finger protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    100125288 (ZGLP1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys4 GATA-factors
    100125288 (ZGLP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GATA ArfGap
Motif
Other DBs
NCBI-GeneID: 100125288
NCBI-ProteinID: NP_001096637
OMIM: 611639
HGNC: 37245
Ensembl: ENSG00000220201
Vega: OTTHUMG00000152114
Pharos: P0C6A0(Tdark)
UniProt: P0C6A0
Position
19p13.2
AA seq 271 aa AA seqDB search
MTEPQVGCVACPRVHKEPAQVGTPWPAKPRSHPRKRDPTALLPRSLWPACQESVTALCFL
QETVERLGQSPAQDTPVLGPCWDPMALGTQGRLLLDRDSKDTQTRISQKGRRLQPPGTPS
APPQRRPRKQLNPCRGTERVDPGFEGVTLKFQIKPDSSLQIIPTYSLPCSSRSQESPADA
VGGPAAHPGGTEAHSAGSEALEPRRCASCRTQRTPLWRDAEDGTPLCNACGIRYKKYGTR
CSSCWLVPRKNVQPKRLCGRCGVSLDPIQEG
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacctcaggtggggtgtgtagcctgtccaagggtacacaaagagccggcccaa
gttggaaccccctggccggctaaacccaggagtcacccaagaaaacgtgaccccactgcc
cttctccccaggtccctctggcctgcatgccaggagtcggtcaccgccctgtgcttcctc
caagagacagtggagaggctgggtcagtcccctgcccaggacaccccggtcctggggcct
tgctgggacccgatggctctggggactcagggccgcctgctgctggacagggattccaag
gacacacagaccaggatcagccaaaagggccgccgtctgcagcccccggggactccctcg
gccccaccccagagaaggccccggaaacagctgaacccctgccggggcaccgagagagtg
gaccctgggttcgagggggtgactctgaagtttcagataaagccggactccagcctgcag
atcatccccacgtacagcctgccctgcagtagccgttctcaggaatcccctgcagatgct
gttgggggccctgcagcccacccaggaggcaccgaggcccactcagcaggcagcgaggcc
ctggagccccggcgctgtgcttcctgtcggacccagaggaccccgctctggagagacgct
gaagatgggacccctctctgcaacgcctgtgggatcaggtacaagaaatacggcactcgc
tgctccagctgctggctggtgcccaggaaaaatgtccagcccaagaggctatgtggcaga
tgtggagtgtccctggaccccattcaggaaggttaa

DBGET integrated database retrieval system