KEGG   Homo sapiens (human): 100128731
Entry
100128731         CDS       T01001                                 
Symbol
OST4
Name
(RefSeq) oligosaccharyltransferase complex subunit 4, non-catalytic
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Ost4
Other DBs
NCBI-GeneID: 100128731
NCBI-ProteinID: NP_001128165
OMIM: 618932
HGNC: 32483
Ensembl: ENSG00000228474
Pharos: P0C6T2(Tdark)
UniProt: P0C6T2
Structure
Position
2:complement(27070472..27071654)
AA seq 37 aa
MITDVQLAIFANMLGVSLFLLVVLYHYVAVNNPKKQE
NT seq 114 nt   +upstreamnt  +downstreamnt
atgatcacggacgtgcagctcgccatcttcgccaacatgctgggcgtgtcgctcttcttg
cttgtcgttctctatcactacgtggccgtcaacaatcccaagaagcaggaatga

DBGET integrated database retrieval system