KEGG   Homo sapiens (human): 100130274Help
Entry
100130274         CDS       T01001                                 

Gene name
CCDC166
Definition
(RefSeq) coiled-coil domain containing 166
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4515
Motif
Other DBs
NCBI-GeneID: 100130274
NCBI-ProteinID: NP_001156386
HGNC: 41910
Ensembl: ENSG00000255181
Vega: OTTHUMG00000165148
Pharos: P0CW27(Tdark)
UniProt: P0CW27
Position
8q24.3
AA seq 439 aa AA seqDB search
MAPKKKRGPSAGSQPGGAAAAGAEQPLSERAQYLQREHALLSEQLDTCEESVDQVLRENA
FLDREALRLREENRLYASYVSARAQRCAKAIVRLDEQNRVDLAQIHWQRAELASLYHGRE
DGVRAQLLEMEARAAQMAQQVQELQPYKVLQLEQLARIRALERELLHMRVEHTQLLHRVK
RRFLEDKAAFEREARQRVQSLARRAEREAVRALVAHTQAIKADNGRLRQELLLLLRRTQL
LHHTRRQLLEQREQLHREHEDTRDLARVHGWLRRGPGGPPLWERPAFSQPTSRPGSLAAP
ISPSRAASQTPSVVPSRAAPRASSVVPSREASRVPSLVLSSMDSRVPSLATSKVGSRMPS
LTASRAGSRALSLVQSLEGSGISSGSSPRVSSQDTLRSTKSGPKLLSGLSRDRDPALLPP
QSEDSVNAEAAAEASPGRA
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccaagaaaaagcgcgggccgagcgcagggagccagccaggtggtgcggcggcc
gcgggtgccgagcagccgctatcggagcgcgcgcagtacctgcaacgcgaacacgcgctg
ctctcggagcagctggacacctgcgaggagagcgttgaccaggtgctgcgagagaacgcc
ttcctggaccgcgaggcgctgcgcctgcgcgaggagaaccggctctacgccagctacgtg
agcgcgcgcgcccagcgctgcgccaaagccatcgtccggctggacgagcagaaccgcgtg
gacctagcgcagatccactggcagcgggcggaactggcctcgctctaccacgggcgcgag
gacggggtgcgcgcgcagctgttggagatggaggcgcgcgcggcacagatggcacagcag
gtgcaagagctgcagccctacaaggtgctgcagctggagcagctggcccggatccgggcg
ctggagcgcgagctgctgcatatgcgcgtggagcacacgcagctgctccaccgcgtgaag
cggcgcttcctggaggacaaggcggccttcgagcgcgaggcgcgtcagcgcgtgcagtca
ctggcgcggcgcgcggagcgggaggcggtgcgcgcgcttgtggcgcacacgcaggccatc
aaagcggacaacggacgcctgcggcaggagctgctgctgctgctccgccggacccagctg
ctgcaccacacgcggcgccagctgctggaacagcgcgagcaactgcaccgcgagcacgag
gacacgcgggacctggcgcgtgtgcacggctggctgcgcaggggccccggaggcccgccg
ctctgggagcggccggccttctcccagcccacctcgcgccccgggtcattagccgccccc
ataagcccgtcgcgcgcggcctcccagaccccgtctgtggtaccgtcgcgcgcggccccc
cgggcctcgtccgtggtcccgtcgcgcgaggcttcccgggtcccctcgttggtgctatcg
agcatggactccagggtcccatcgctggccacttcaaaggtgggatcccggatgccatcc
ctgaccgcttcgcgcgcaggctcccgggccctgtcgctggtgcagtcactcgagggctct
gggatctcttcggggtcctcaccgagggtgtcctcacaggacactctccgctccacgaag
tctggccccaagcttctctctggcctgtcccgggatcgggatccggctcttctcccccca
cagtcggaggacagcgtgaacgctgaagctgcggcagaagcctccccgggtagagcctga

DBGET integrated database retrieval system