KEGG   Homo sapiens (human): 100130348
Entry
100130348         CDS       T01001                                 

Gene name
TMEM262
Definition
(RefSeq) transmembrane protein 262
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Clc-like
Other DBs
NCBI-GeneID: 100130348
NCBI-ProteinID: NP_001269377
HGNC: 49389
Ensembl: ENSG00000187066
Vega: OTTHUMG00000165598
Pharos: E9PQX1(Tdark)
UniProt: E9PQX1
Position
11q13.1
AA seq 116 aa
MWLQDRIATFFFPKGMMLTTAALMLFFLHLGIFIRDVHNFCITYHYDHMSFHYTVVLMFS
QVISICWAAMGSLYAEMTENKYVCFSALTILMLNGAMFFNRLSLEFLAIEYREEHH
NT seq 351 nt   +upstreamnt  +downstreamnt
atgtggctgcaagaccgcatcgccacgttcttcttcccaaaaggcatgatgctcaccacg
gctgcgctgatgctcttcttcttacacctgggcatcttcatcagagacgtgcacaacttc
tgcatcacctaccactatgaccacatgagctttcactacacggtcgtcctgatgttctcc
caggtgatcagcatctgctgggctgccatggggtcactctatgctgagatgacagaaaac
aagtacgtctgcttctccgccctgaccatcctgatgctcaacggagccatgttcttcaac
cgcctgtccttggagtttctggccatcgagtaccgggaggagcaccactga

DBGET integrated database retrieval system